Scaffold Ga0065200_1213744

Overview

Basic Information

• Taxon OID: 3300004330
• Scaffold ID: Ga0065200_1213744
• Source Dataset Name: Marine microbial communities from Galveston Bay (CSEDA13C- fraction 6)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Shell Corporation
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1367
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Sediment → Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations

Source Dataset Sampling Location

• Location Name: Galveston Bay, USA
• Coordinates
  • Lat. (^o): 29.5
  • Long. (^o): -94.76

Associated Families

Family	Category	Number of Sequences	3D Structure?
F048676	Metagenome / Metatranscriptome	148	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0065200_12137443	F048676	AGG	MLFRYSRLCGTASDAVDAVKLEILKGFKLLKLKLTEYLKNIIKLTISKI*