Scaffold Ga0064458_1012864

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0064458_1012864

Scaffold Ga0064458_1012864

Overview

Basic Information
Taxon OID	3300004090 Open in IMG/M
Scaffold ID	Ga0064458_1012864 Open in IMG/M
Source Dataset Name	Eurytemora affinis associated microbial communities from Braddock Bay, NY (Lake Ontario)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Maryland School of Medicine
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1071
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Arthropoda → Unclassified → Unclassified → Unclassified → Eurytemora Affinis Associated → Eurytemora Affinis Associated Microbial Communities From Braddock Bay, Ny (Lake Ontario)

Source Dataset Sampling Location
Location Name	Braddock Bay, NY, USA
Coordinates	Lat. (^o)	43.30746	Long. (^o)	-77.707341	Alt. (m)		Depth (m)	2
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059702	Metagenome	133	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0064458_10128641	F059702	N/A	MLVKKQMNYFDVPWEHEWKVPVLQELLNTRMNNLYVEGFDDYVITEMINMLY

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.