| Basic Information | |
|---|---|
| Family ID | F059702 |
| Family Type | Metagenome |
| Number of Sequences | 133 |
| Average Sequence Length | 51 residues |
| Representative Sequence | MLVKKQMKYFDVPLDHAWKVPVLQELLNTRTNNLYVEGFDDYVITEMINMLCNE |
| Number of Associated Samples | 19 |
| Number of Associated Scaffolds | 133 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 25.56 % |
| % of genes near scaffold ends (potentially truncated) | 30.08 % |
| % of genes from short scaffolds (< 2000 bps) | 66.92 % |
| Associated GOLD sequencing projects | 19 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (72.932 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton (75.940 % of family members) |
| Environment Ontology (ENVO) | Unclassified (75.940 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (84.211 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.68% β-sheet: 0.00% Coil/Unstructured: 57.32% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 133 Family Scaffolds |
|---|---|---|
| PF00656 | Peptidase_C14 | 0.75 |
| PF00132 | Hexapep | 0.75 |
| COG ID | Name | Functional Category | % Frequency in 133 Family Scaffolds |
|---|---|---|---|
| COG4249 | Uncharacterized conserved protein, contains caspase domain | General function prediction only [R] | 0.75 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 72.93 % |
| All Organisms | root | All Organisms | 27.07 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004090|Ga0064458_1003545 | Not Available | 925 | Open in IMG/M |
| 3300004090|Ga0064458_1012864 | Not Available | 1071 | Open in IMG/M |
| 3300004090|Ga0064458_1018625 | Not Available | 785 | Open in IMG/M |
| 3300004090|Ga0064458_1020414 | Not Available | 1208 | Open in IMG/M |
| 3300004090|Ga0064458_1037909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae → Fictibacillus → Fictibacillus macauensis | 668 | Open in IMG/M |
| 3300004090|Ga0064458_1213277 | Not Available | 954 | Open in IMG/M |
| 3300004090|Ga0064458_1242369 | Not Available | 898 | Open in IMG/M |
| 3300005069|Ga0071350_1014714 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis | 1886 | Open in IMG/M |
| 3300005069|Ga0071350_1033553 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis | 1375 | Open in IMG/M |
| 3300005069|Ga0071350_1076616 | Not Available | 999 | Open in IMG/M |
| 3300005069|Ga0071350_1100354 | Not Available | 898 | Open in IMG/M |
| 3300005069|Ga0071350_1153649 | Not Available | 760 | Open in IMG/M |
| 3300005069|Ga0071350_1157515 | Not Available | 752 | Open in IMG/M |
| 3300005069|Ga0071350_1222030 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis | 651 | Open in IMG/M |
| 3300005069|Ga0071350_1230346 | Not Available | 641 | Open in IMG/M |
| 3300005069|Ga0071350_1278842 | Not Available | 588 | Open in IMG/M |
| 3300005069|Ga0071350_1347889 | Not Available | 528 | Open in IMG/M |
| 3300005069|Ga0071350_1363337 | Not Available | 517 | Open in IMG/M |
| 3300006917|Ga0075472_10472650 | Not Available | 623 | Open in IMG/M |
| 3300007543|Ga0102853_1020599 | Not Available | 1082 | Open in IMG/M |
| 3300007545|Ga0102873_1175297 | Not Available | 645 | Open in IMG/M |
| 3300007620|Ga0102871_1130387 | Not Available | 714 | Open in IMG/M |
| 3300007621|Ga0102872_1122409 | Not Available | 694 | Open in IMG/M |
| 3300007625|Ga0102870_1165013 | Not Available | 635 | Open in IMG/M |
| 3300007625|Ga0102870_1200835 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis | 567 | Open in IMG/M |
| 3300007642|Ga0102876_1082792 | Not Available | 877 | Open in IMG/M |
| 3300007653|Ga0102868_1061271 | All Organisms → cellular organisms → Eukaryota | 832 | Open in IMG/M |
| 3300007653|Ga0102868_1066291 | Not Available | 801 | Open in IMG/M |
| 3300007706|Ga0102899_1100740 | Not Available | 704 | Open in IMG/M |
| 3300007953|Ga0105738_1091173 | Not Available | 542 | Open in IMG/M |
| 3300008118|Ga0114352_1105806 | Not Available | 586 | Open in IMG/M |
| 3300008121|Ga0114356_1004439 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis | 17387 | Open in IMG/M |
| 3300008121|Ga0114356_1005467 | Not Available | 7572 | Open in IMG/M |
| 3300008121|Ga0114356_1005488 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis | 7561 | Open in IMG/M |
| 3300008121|Ga0114356_1005889 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis | 7416 | Open in IMG/M |
| 3300008121|Ga0114356_1006156 | Not Available | 7334 | Open in IMG/M |
| 3300008121|Ga0114356_1008370 | Not Available | 6710 | Open in IMG/M |
| 3300008121|Ga0114356_1009620 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis | 7392 | Open in IMG/M |
| 3300008121|Ga0114356_1010172 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis | 6338 | Open in IMG/M |
| 3300008121|Ga0114356_1012932 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis | 5878 | Open in IMG/M |
| 3300008121|Ga0114356_1013204 | Not Available | 12161 | Open in IMG/M |
| 3300008121|Ga0114356_1015405 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis | 5555 | Open in IMG/M |
| 3300008121|Ga0114356_1015882 | Not Available | 5499 | Open in IMG/M |
| 3300008121|Ga0114356_1015883 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis | 5499 | Open in IMG/M |
| 3300008121|Ga0114356_1017556 | Not Available | 6945 | Open in IMG/M |
| 3300008121|Ga0114356_1022568 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis | 4862 | Open in IMG/M |
| 3300008121|Ga0114356_1025820 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis | 4621 | Open in IMG/M |
| 3300008121|Ga0114356_1025852 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis | 4620 | Open in IMG/M |
| 3300008121|Ga0114356_1029837 | Not Available | 6669 | Open in IMG/M |
| 3300008121|Ga0114356_1034349 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis | 8347 | Open in IMG/M |
| 3300008121|Ga0114356_1038764 | Not Available | 3931 | Open in IMG/M |
| 3300008121|Ga0114356_1045368 | Not Available | 3672 | Open in IMG/M |
| 3300008121|Ga0114356_1048052 | Not Available | 3577 | Open in IMG/M |
| 3300008121|Ga0114356_1049728 | Not Available | 3522 | Open in IMG/M |
| 3300008121|Ga0114356_1050398 | Not Available | 3499 | Open in IMG/M |
| 3300008121|Ga0114356_1060242 | Not Available | 3695 | Open in IMG/M |
| 3300008121|Ga0114356_1060979 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis | 3202 | Open in IMG/M |
| 3300008121|Ga0114356_1068757 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis | 3015 | Open in IMG/M |
| 3300008121|Ga0114356_1068877 | Not Available | 3012 | Open in IMG/M |
| 3300008121|Ga0114356_1070852 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis | 2969 | Open in IMG/M |
| 3300008121|Ga0114356_1071631 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda | 4306 | Open in IMG/M |
| 3300008121|Ga0114356_1076728 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis | 2847 | Open in IMG/M |
| 3300008121|Ga0114356_1090146 | Not Available | 4619 | Open in IMG/M |
| 3300008121|Ga0114356_1102881 | Not Available | 3309 | Open in IMG/M |
| 3300008121|Ga0114356_1110232 | Not Available | 3193 | Open in IMG/M |
| 3300008121|Ga0114356_1119196 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis | 2199 | Open in IMG/M |
| 3300008121|Ga0114356_1128454 | Not Available | 2094 | Open in IMG/M |
| 3300008121|Ga0114356_1134787 | Not Available | 2026 | Open in IMG/M |
| 3300008121|Ga0114356_1134845 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis | 2026 | Open in IMG/M |
| 3300008121|Ga0114356_1135293 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis | 2021 | Open in IMG/M |
| 3300008121|Ga0114356_1135984 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis | 2015 | Open in IMG/M |
| 3300008121|Ga0114356_1139757 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Tenacibaculum → unclassified Tenacibaculum → Tenacibaculum sp. | 1977 | Open in IMG/M |
| 3300008121|Ga0114356_1140189 | Not Available | 1973 | Open in IMG/M |
| 3300008121|Ga0114356_1145701 | Not Available | 1920 | Open in IMG/M |
| 3300008121|Ga0114356_1146151 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis | 1916 | Open in IMG/M |
| 3300008121|Ga0114356_1153229 | Not Available | 1853 | Open in IMG/M |
| 3300008121|Ga0114356_1159204 | Not Available | 1801 | Open in IMG/M |
| 3300008121|Ga0114356_1160456 | Not Available | 1790 | Open in IMG/M |
| 3300008121|Ga0114356_1162547 | Not Available | 1773 | Open in IMG/M |
| 3300008121|Ga0114356_1177880 | Not Available | 1654 | Open in IMG/M |
| 3300008121|Ga0114356_1180962 | Not Available | 2199 | Open in IMG/M |
| 3300008121|Ga0114356_1199199 | Not Available | 1511 | Open in IMG/M |
| 3300008121|Ga0114356_1200015 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis | 2213 | Open in IMG/M |
| 3300008121|Ga0114356_1210040 | Not Available | 1445 | Open in IMG/M |
| 3300008121|Ga0114356_1221285 | Not Available | 1381 | Open in IMG/M |
| 3300008121|Ga0114356_1224161 | Not Available | 1366 | Open in IMG/M |
| 3300008121|Ga0114356_1227533 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis | 2006 | Open in IMG/M |
| 3300008121|Ga0114356_1238629 | Not Available | 1292 | Open in IMG/M |
| 3300008121|Ga0114356_1239198 | Not Available | 1289 | Open in IMG/M |
| 3300008121|Ga0114356_1247274 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis | 1251 | Open in IMG/M |
| 3300008121|Ga0114356_1249322 | Not Available | 1885 | Open in IMG/M |
| 3300008121|Ga0114356_1250101 | Not Available | 1238 | Open in IMG/M |
| 3300008121|Ga0114356_1252972 | Not Available | 1225 | Open in IMG/M |
| 3300008121|Ga0114356_1264836 | Not Available | 2318 | Open in IMG/M |
| 3300008121|Ga0114356_1278326 | Not Available | 1119 | Open in IMG/M |
| 3300008121|Ga0114356_1278833 | Not Available | 1117 | Open in IMG/M |
| 3300008121|Ga0114356_1282750 | Not Available | 1102 | Open in IMG/M |
| 3300008121|Ga0114356_1289909 | Not Available | 1465 | Open in IMG/M |
| 3300008121|Ga0114356_1292641 | Not Available | 1065 | Open in IMG/M |
| 3300008121|Ga0114356_1304094 | Not Available | 1025 | Open in IMG/M |
| 3300008121|Ga0114356_1308028 | Not Available | 1012 | Open in IMG/M |
| 3300008121|Ga0114356_1309363 | Not Available | 1007 | Open in IMG/M |
| 3300008121|Ga0114356_1320646 | Not Available | 971 | Open in IMG/M |
| 3300008121|Ga0114356_1327093 | Not Available | 951 | Open in IMG/M |
| 3300008121|Ga0114356_1337181 | Not Available | 921 | Open in IMG/M |
| 3300008121|Ga0114356_1337381 | Not Available | 921 | Open in IMG/M |
| 3300008121|Ga0114356_1339113 | Not Available | 916 | Open in IMG/M |
| 3300008121|Ga0114356_1350156 | Not Available | 886 | Open in IMG/M |
| 3300008121|Ga0114356_1356736 | Not Available | 868 | Open in IMG/M |
| 3300008121|Ga0114356_1357377 | Not Available | 867 | Open in IMG/M |
| 3300008121|Ga0114356_1390471 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda | 788 | Open in IMG/M |
| 3300008121|Ga0114356_1413777 | Not Available | 738 | Open in IMG/M |
| 3300008121|Ga0114356_1426663 | Not Available | 713 | Open in IMG/M |
| 3300008121|Ga0114356_1435990 | Not Available | 695 | Open in IMG/M |
| 3300008121|Ga0114356_1477653 | Not Available | 625 | Open in IMG/M |
| 3300008121|Ga0114356_1481595 | Not Available | 619 | Open in IMG/M |
| 3300008121|Ga0114356_1487143 | Not Available | 611 | Open in IMG/M |
| 3300008121|Ga0114356_1491907 | Not Available | 604 | Open in IMG/M |
| 3300008121|Ga0114356_1526944 | Not Available | 554 | Open in IMG/M |
| 3300008121|Ga0114356_1552785 | Not Available | 522 | Open in IMG/M |
| 3300008122|Ga0114359_1095738 | Not Available | 1051 | Open in IMG/M |
| 3300008265|Ga0114361_1067698 | Not Available | 1646 | Open in IMG/M |
| 3300008265|Ga0114361_1109577 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis | 1178 | Open in IMG/M |
| 3300008265|Ga0114361_1120130 | Not Available | 817 | Open in IMG/M |
| 3300008265|Ga0114361_1140476 | Not Available | 753 | Open in IMG/M |
| 3300008265|Ga0114361_1143435 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis | 745 | Open in IMG/M |
| 3300008265|Ga0114361_1164832 | Not Available | 692 | Open in IMG/M |
| 3300008265|Ga0114361_1223797 | Not Available | 584 | Open in IMG/M |
| 3300008265|Ga0114361_1317670 | Not Available | 755 | Open in IMG/M |
| 3300008966|Ga0114357_1298684 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis | 555 | Open in IMG/M |
| 3300008966|Ga0114357_1306910 | Not Available | 543 | Open in IMG/M |
| 3300009057|Ga0102892_1094918 | Not Available | 580 | Open in IMG/M |
| 3300024348|Ga0244776_10908888 | Not Available | 521 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 75.94% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 9.02% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 8.27% |
| Eurytemora Affinis Associated | Host-Associated → Arthropoda → Unclassified → Unclassified → Unclassified → Eurytemora Affinis Associated | 5.26% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.75% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.75% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004090 | Eurytemora affinis associated microbial communities from Braddock Bay, NY (Lake Ontario) | Host-Associated | Open in IMG/M |
| 3300005069 | Metagenomes from Harmful Algal Blooms in Lake Erie, HABS-E2014-0024 | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007543 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-3 | Environmental | Open in IMG/M |
| 3300007545 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 | Environmental | Open in IMG/M |
| 3300007620 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-02 | Environmental | Open in IMG/M |
| 3300007621 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-3 | Environmental | Open in IMG/M |
| 3300007625 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-02 | Environmental | Open in IMG/M |
| 3300007642 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3 | Environmental | Open in IMG/M |
| 3300007653 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-3 | Environmental | Open in IMG/M |
| 3300007706 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-3 | Environmental | Open in IMG/M |
| 3300007953 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_3um | Environmental | Open in IMG/M |
| 3300008118 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-100-LTR | Environmental | Open in IMG/M |
| 3300008121 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-100-LTR | Environmental | Open in IMG/M |
| 3300008122 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample HABS-E2014-0124-100-LTR | Environmental | Open in IMG/M |
| 3300008265 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0126-100-LTR | Environmental | Open in IMG/M |
| 3300008966 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-53-LTR | Environmental | Open in IMG/M |
| 3300009057 | Estuarine microbial communities from the Columbia River estuary - metaG 1553A-3 | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0064458_10035451 | 3300004090 | Eurytemora Affinis Associated | MKCFDVPLEHEWKVPVSQELLNTRMNNLYVEGFDDYVITEMINMLC |
| Ga0064458_10128641 | 3300004090 | Eurytemora Affinis Associated | MLVKKQMNYFDVPWEHEWKVPVLQELLNTRMNNLYVEGFDDYVITEMINMLY |
| Ga0064458_10186251 | 3300004090 | Eurytemora Affinis Associated | MLVKKQMKYFDVPLEHEWKVPVLQELLNTRMNNLNVEGFDDYVITEMINML |
| Ga0064458_10204141 | 3300004090 | Eurytemora Affinis Associated | MLVKKQMKYFDVPLEHAWKVGFLSTRMNNFYVEGFDDYVITEMINMLCN |
| Ga0064458_10379091 | 3300004090 | Eurytemora Affinis Associated | VNIFSVCVLYCIDVPLEHEWKVPVLQELLSTRMNNLYVEGFDDYVITEMINMLCSE* |
| Ga0064458_12132772 | 3300004090 | Eurytemora Affinis Associated | MLVKKQMKYFDVPLEHEWKVPVLQELLSTRMNNLYVEGFDDYVITEMINMLCSE* |
| Ga0064458_12423691 | 3300004090 | Eurytemora Affinis Associated | MKKMKYFDVPLEHEWKVPVLQELLNTRMNNLYVEGFDDYVITEMINMLCSE* |
| Ga0071350_10147143 | 3300005069 | Freshwater | MLVKKQIKYFDVPLEHAWKVPVLQELLNTRMNNLYVEGFDDYVITEM |
| Ga0071350_10335531 | 3300005069 | Freshwater | MLVKKQMKYFDVPLDHAWKVPVLQELLNTRTNNLYVEGFDDYVITEMINMLCNE* |
| Ga0071350_10766162 | 3300005069 | Freshwater | MKYFDVPLDRAWKVPVLQELLHTRTHNLYFEGLDDYVITELINMLCNE* |
| Ga0071350_11003541 | 3300005069 | Freshwater | MKYFDVSLNHTWKVPALQELLNTRVNNLYVEGFDDYVITEMINM* |
| Ga0071350_11536492 | 3300005069 | Freshwater | VKKQMIYFDVSLGHPLKALIILELLNTRMNNLYAEGFDDYVITEMINMLCNEK* |
| Ga0071350_11575151 | 3300005069 | Freshwater | MLVKKQMKFFDVPLDHGWKVLVFQELLNTRTNNLYVEGFDDYIITKMINLLCNE* |
| Ga0071350_12220301 | 3300005069 | Freshwater | MFVKKQMKYFDVPLEHEWKFPVLQELLNTRMNNLYVEGFDDYEITEMINTLCNE* |
| Ga0071350_12303462 | 3300005069 | Freshwater | MTYYDVPLELAWNVPILQELLKTRMNSLYVDGFDDYVITEMINMLCNEY* |
| Ga0071350_12788421 | 3300005069 | Freshwater | MLVKKQMKYFDVPLEHAWKVPVLQELLNTRMNNLYVKGFDDYVITEMINMLCNE* |
| Ga0071350_13478892 | 3300005069 | Freshwater | MLVKKQMKYFDVIGPYMKSSILQELFNTRTNNLYVEGFDDYVITEMINSYVMSYNQ |
| Ga0071350_13633372 | 3300005069 | Freshwater | MYVILVNLSEMLVKKQMKYFDVPLEHAWKVPVLQELLSTRMNSLYVEGFDDYVITEMINMLCNE* |
| Ga0075472_104726502 | 3300006917 | Aqueous | MLVKKQIKYFDVPLEHEWKVPVLQELLSTRMNNLYVEGFDDYVITEMIKLLCNVLETCIFKNLF* |
| Ga0102853_10205991 | 3300007543 | Estuarine | MLVKKQMKYFDVPLDHAWKVPILQELLNTRMNNLYVEGFDDYMITEMINMLCNE* |
| Ga0102873_11752971 | 3300007545 | Estuarine | MLVRKQMKYFDVPLDHAWKVPILQELLNTRMNNLYVEGFDDYMITEMINMKCNV* |
| Ga0102871_11303871 | 3300007620 | Estuarine | MLVKKQMKYFDVPLDHAWKVPILQELLNTRMNNLYVEGFDDYMITEVINMLCNE* |
| Ga0102872_11224092 | 3300007621 | Estuarine | MLVKKQIKYFNVPLDHAWKVPILQELLNTRMNNLYVEGFDDYMI |
| Ga0102870_11650131 | 3300007625 | Estuarine | MLVKKQIKYFDVPLDHAWKVPILQELLNTKMNSLHVEGFDDYMITKMINMLCNE* |
| Ga0102870_12008351 | 3300007625 | Estuarine | MKHFDVPLDHASKVPILLEILNTRINNTYVEGFDDYVITEMINMLCN |
| Ga0102876_10827921 | 3300007642 | Estuarine | MLVKKQMKYFDVPLDHAWKVPILQELLNTRMNNLYVAGFDDYMITEMINMLCNE* |
| Ga0102868_10612712 | 3300007653 | Estuarine | MLVMKQMKYFDVPTLDHTWKLLILHELLITRKTNLYVEGFEDYILTKMINMCNKYSNKPKFV* |
| Ga0102868_10662911 | 3300007653 | Estuarine | MLVKKQMKYFDVPLDHAWKVPILQELLNTRMNNLYVEGFDDYMKTEMINMLCNE* |
| Ga0102899_11007401 | 3300007706 | Estuarine | MLVKKQMKYFDVPLDHAWKVPILQELLNTRINNLYVEGFDDYMITEMINMLCNE* |
| Ga0105738_10911731 | 3300007953 | Estuary Water | MLVKKQMKYFDVPLDHAWKVPILQELLKTRKTNLFVEGFDDHVITEIINMLFKE* |
| Ga0114352_11058061 | 3300008118 | Freshwater, Plankton | LDHAWKVPVLQELLNI*MNNLYVEGFDDYVISEMINMLCKK* |
| Ga0114356_10044394 | 3300008121 | Freshwater, Plankton | MLVKKQMKYFTVPLEHVWKVPVLQELLNTRMNNLYVERFDDYVITEMINMLCNE* |
| Ga0114356_10054673 | 3300008121 | Freshwater, Plankton | MLVKKQMKYFDVPLEHAWKVPVLQELLSTRMNSLYVEGFDDYVITEMINMLCNE* |
| Ga0114356_10054883 | 3300008121 | Freshwater, Plankton | MKYFDVSLDHAWKVSILQELLNTRIKNLYIEGFHDYLIPEMINILGNE* |
| Ga0114356_10058893 | 3300008121 | Freshwater, Plankton | MKYFDVSSDHEWKVLILRNKDTRMNNLYVEGFNDYVITKMINMLCNE* |
| Ga0114356_10061561 | 3300008121 | Freshwater, Plankton | MLVKKQMNYFDVPWEHEWKVPVLQELLNTRMNNLYVEGFDDYVITEMINMLYNE* |
| Ga0114356_10083701 | 3300008121 | Freshwater, Plankton | MKYFDVPLEHAWKVPVLQELLNTGFDDYVITEMINMLCNE* |
| Ga0114356_10096202 | 3300008121 | Freshwater, Plankton | MLVKKQMKYFDVPFDHAWKVPVLKELLNTRTNNLNVEEFNDYEIPEMVNMFFTE* |
| Ga0114356_10101723 | 3300008121 | Freshwater, Plankton | MLVKKQIKYFDVPLDHAWKVPVLQELLYTRTNNLYVEGFDDYVITEMINMLCNE* |
| Ga0114356_10129322 | 3300008121 | Freshwater, Plankton | MLVKKQMKYFDVPLDHAWKVPVLQELLNTRMNNLYVKGFDDYVITEMTNMLCNK* |
| Ga0114356_10132044 | 3300008121 | Freshwater, Plankton | MLVKKQMKYFDVPLEHAWRVPVLQELLNTRMNNLYVEGFDDYVITEMINMLCNE* |
| Ga0114356_10154051 | 3300008121 | Freshwater, Plankton | MIVKKQVKYFDVPLDHAWKVPFLNTRTNNLYVEVIDDYVITEMINMLWNE* |
| Ga0114356_10158824 | 3300008121 | Freshwater, Plankton | MLVKKQIKYIDVLLDHAWKVLVLQELLNTRTNNLYAEGFDDYIITEMVNMFYNE* |
| Ga0114356_10158831 | 3300008121 | Freshwater, Plankton | MKYFDVPLDHEWKVPVLQELLNTGTNNLYVEGFDDYVITKMINILCND* |
| Ga0114356_10175564 | 3300008121 | Freshwater, Plankton | MLVKKQMKYFDVQLDHAWKVPVLQELLNTRTNNLYVEGFDDYVITEIINMVCND* |
| Ga0114356_10225682 | 3300008121 | Freshwater, Plankton | MLVKKQMKYFDVPLEHEWKVPVLQELLSTRMNDLYVEGFDDYVITEMINMLCSE* |
| Ga0114356_10258201 | 3300008121 | Freshwater, Plankton | MLVKKQMKYFDVPLDHAWTVPVLQELLNTRTNNLYVEGFDDYAITEMIKICYVLSNDQ* |
| Ga0114356_10258522 | 3300008121 | Freshwater, Plankton | MKYFDVPLEHAWKVPVLQELLNTRTNNLYVEGFDDCVITEMINKYLM* |
| Ga0114356_10298372 | 3300008121 | Freshwater, Plankton | LAKLAEIMKYFDVLLEHAWKVPVLQELLNTRMNNLYVEGFDDYVITEMINILCND* |
| Ga0114356_10343494 | 3300008121 | Freshwater, Plankton | MKYFYVPLDHAWKVPVLQELVNTRMNNFYVERFDDYVITEMNKYVM* |
| Ga0114356_10387644 | 3300008121 | Freshwater, Plankton | FDVPLEHAWKVPVLQELLNTRMNNLYVEGFDDYVITEILNMLCNE* |
| Ga0114356_10453681 | 3300008121 | Freshwater, Plankton | MKYFDVPLEHEWKVPVLQELLNTRMKNLYVEGFDDYVITEMINMLCSE* |
| Ga0114356_10480521 | 3300008121 | Freshwater, Plankton | MLVKKQMKYFDVPLDHARKVPVLQELLNTRTNNLYVEGFDYYVLTEMINMLCND* |
| Ga0114356_10497281 | 3300008121 | Freshwater, Plankton | QMKYFDVPLEHEWKVPVLQELLNTRMNNLYVEGFDDYVLTEMINMLSSE* |
| Ga0114356_10503983 | 3300008121 | Freshwater, Plankton | MFVKKQMKYFDVPLEHEWKFPVLQELVNTRTNNLYVEGFDDYVITEIINMLCNE* |
| Ga0114356_10602421 | 3300008121 | Freshwater, Plankton | MLVKKQMKYFDVPLEHAWKVSVLQELLNTRTNNLYVEGFDDYVITEMINIYMFCYE* |
| Ga0114356_10609791 | 3300008121 | Freshwater, Plankton | MKYFDVPLEHAWKVPVLQQLLNTRTNNLYVEGFDDYVITAAMINMLCNE* |
| Ga0114356_10687572 | 3300008121 | Freshwater, Plankton | MLVKKQMKYFDVPLEHECKVPVLQELLNTRMNNLYVEGFDDYIITEMINMLCNE* |
| Ga0114356_10688772 | 3300008121 | Freshwater, Plankton | MKYFDVPLDHAWKVSVLQELLNTRMNNLYVEGFDDYVITEMTNMLCIE* |
| Ga0114356_10708521 | 3300008121 | Freshwater, Plankton | LEHAWKVPVLKELLNKRRNNLYLEGFDDYVITEMINILCYE* |
| Ga0114356_10716313 | 3300008121 | Freshwater, Plankton | MLVKKQIKYFDVPLEHQIIYNNLYVEGFDDYVITEMINMLCN* |
| Ga0114356_10767282 | 3300008121 | Freshwater, Plankton | MLVKKQLKYFDVPLDHAWKVPVLQELSNTIRNNSYVEGFDDYVITEMINMLCNE* |
| Ga0114356_10901462 | 3300008121 | Freshwater, Plankton | MLVKKQMNCFDVLMDHAWKVPVLQELLNTRMNNLYVEGFDDYVITEMINMLCSKP* |
| Ga0114356_11028813 | 3300008121 | Freshwater, Plankton | MLVKKQMKYFDVPLDHVWKVPVLQELLNTRMNNLYVDGFDD* |
| Ga0114356_11102323 | 3300008121 | Freshwater, Plankton | MMHHNILLKFPLDHAWKVPVLQELLNTRTNNLYVDGFDDHVITEMINMLCNE* |
| Ga0114356_11191961 | 3300008121 | Freshwater, Plankton | CSVNPSDLSKMLVKKQMKYFDVPLEHAWKVPVLQELLNTGTNSLYVERFDDYVITEMMNMLCNE* |
| Ga0114356_11284542 | 3300008121 | Freshwater, Plankton | MLVKQQMKYFDVPLDHAWKVLVLQELLNTITNNLYVEGFDDYVITEMINMLCNE* |
| Ga0114356_11347871 | 3300008121 | Freshwater, Plankton | MKYFDVPLDHGWKVPVFQELLNTRTNNLYVEGFDDYIITEMINFLCKE* |
| Ga0114356_11348451 | 3300008121 | Freshwater, Plankton | MKTNEIF*FPLDHAWKVPILQELLNTRMNNLHVEGFDDYVITEMINMLCNE* |
| Ga0114356_11352931 | 3300008121 | Freshwater, Plankton | NDCSVNPSDLSKMLVKKQMKYFDVPLDHAWKVPVLQELLNTRTDNLYVEGFDDYVINEMINMLCNE* |
| Ga0114356_11359841 | 3300008121 | Freshwater, Plankton | MKYFDVPLEHAWKVPVLQELLNTRMNNSYVEGFDDYVITEMINMLCNE* |
| Ga0114356_11397572 | 3300008121 | Freshwater, Plankton | MLVKKQMKYFDVPLEHEEHEWKVPVLQELLNTRMNNLYVEGFDDYVITEMINMICNE* |
| Ga0114356_11401893 | 3300008121 | Freshwater, Plankton | MLVKKQMKYFDVPLEHEWKVPVSQELLSTRINNLYDKGFNVYVITEMIHMLCSE* |
| Ga0114356_11457011 | 3300008121 | Freshwater, Plankton | MLVKKQINYFDVPLDHAWKVSILQELLNTRTNNLYVEGFDDYVITEMIICYVMNNG* |
| Ga0114356_11461513 | 3300008121 | Freshwater, Plankton | MKYFDVPLEHEWKFPVLQELLNTRMNNLYVEGFDDYVITEMINMLCSEKKSIFSICTDFAYFLLETCIFKNLFKQI* |
| Ga0114356_11532292 | 3300008121 | Freshwater, Plankton | MLVDKQMKYFDVPLDHAWNVPVLQELLNTRTNSLYVEGFDEYVITE* |
| Ga0114356_11592041 | 3300008121 | Freshwater, Plankton | LEHA*KVPVLQELLNTRMNNLYVEGFDDYVITEMINMLCSEEKSIFSICA* |
| Ga0114356_11604561 | 3300008121 | Freshwater, Plankton | MLVKKLIEYFDVPLDHAWKVPVLQELLNKRTNSLYVEGFDDYVITEMINKLCNK* |
| Ga0114356_11625472 | 3300008121 | Freshwater, Plankton | MKYFDVPLDHAWKVPVLQELLNTRTNNLHIEGFDDYVITEMINMLCN* |
| Ga0114356_11778801 | 3300008121 | Freshwater, Plankton | VKKQMKYFDVPLEHAWKVPVLQELLNTRMNNLYVEGFDDYVITEMINMLYYE* |
| Ga0114356_11809621 | 3300008121 | Freshwater, Plankton | VPLEHAWKVPVLQELLNTRMNNLYVEGFDDYVITEMISMLCNE* |
| Ga0114356_11991991 | 3300008121 | Freshwater, Plankton | MKYFDVPLDHAWKVPVLQEFLNTRMNNLYVEGFDDYVITEMINMLCNE* |
| Ga0114356_12000151 | 3300008121 | Freshwater, Plankton | KQMKYFDVPLEHEWKVPVLQELLSTRMNNLYVEGFDDYVITEMINMLCSE* |
| Ga0114356_12100401 | 3300008121 | Freshwater, Plankton | MLVKKQMKYFDVPLDYAWKVPVLQELLNTRTNNLYVEGFDDYVITEIINILCNE* |
| Ga0114356_12212851 | 3300008121 | Freshwater, Plankton | LKYFDVPLEHAWKVPVLQELLNTRMNNLFVEGYDDYVITEMINML* |
| Ga0114356_12241611 | 3300008121 | Freshwater, Plankton | MDHAWKVLVLQELLNTRTNNLCVEGFDDYVIAEMINMLSNE* |
| Ga0114356_12275331 | 3300008121 | Freshwater, Plankton | LSKMLVKKQMKYFNVPLEHEWKVPVLQELLNTRMNNLCVEGFDDYVITEIINMLCSE* |
| Ga0114356_12386291 | 3300008121 | Freshwater, Plankton | MLVKKQMKYFDVPLEHEWKVPVLQELLNTRMNNLYVEGFDDYDITEMINMLCSE* |
| Ga0114356_12391982 | 3300008121 | Freshwater, Plankton | MLVKKQMKYFDVPLEHAWKVLVLQELLNTRMNNLYIEGFDDYVITEMINMLCNE* |
| Ga0114356_12472741 | 3300008121 | Freshwater, Plankton | MKYFNVPLDHEWKVPVLQELLNTRTNNLYVEGFDDYVITEMINMLCDE* |
| Ga0114356_12493222 | 3300008121 | Freshwater, Plankton | FDVPLEHEWKVPVLQELLNTRMNNLYVEGFDDYVITEIINMLCSE* |
| Ga0114356_12501011 | 3300008121 | Freshwater, Plankton | MLVKKQLKYFDVPLEHAWKVPVLQELLNTRMNNLYVEGFDDYVI |
| Ga0114356_12529721 | 3300008121 | Freshwater, Plankton | MLVKKQMKYFDVPLEHEWKVPVLQELLNTRMNNLYVKGFDDHVITEMINMLRSE* |
| Ga0114356_12648364 | 3300008121 | Freshwater, Plankton | MLVKKQMKYFDVPLDHAWKVPVLQELLNTRTNNLYVEGFDDYVITEIIYILCNE* |
| Ga0114356_12783262 | 3300008121 | Freshwater, Plankton | MLVKKQLKYFYVPLEHAWKVPVLQELLNTRTNNLYVEGFDDYVITEMINMVCNE* |
| Ga0114356_12788331 | 3300008121 | Freshwater, Plankton | MFVKKQMKYFDVPLEYEWKVPVLQELLNTRMNNLYVQGFDDYVITEMINMLCSE* |
| Ga0114356_12827501 | 3300008121 | Freshwater, Plankton | MLVKKQMKYFDVPLEHEWKVPVLQELLKTRMDNLYVEGFDDYVMTEKINMVCNE* |
| Ga0114356_12899091 | 3300008121 | Freshwater, Plankton | MKYFDVPLEHEWKVLVLQELLNTRMNNLYVEGFDDYVITEMINMLCNE* |
| Ga0114356_12926411 | 3300008121 | Freshwater, Plankton | MLVKKQMKFFDVLLEHGWKFPVLQELLNTKMNNLYVKGFDDYVITEMINMLCNE* |
| Ga0114356_13040941 | 3300008121 | Freshwater, Plankton | PLDHVWKVPVLQELLNTRMNNLYVELFDDYIITVMINMLSNE* |
| Ga0114356_13080282 | 3300008121 | Freshwater, Plankton | MLVKKQMKYFDVPLDHEWKVPVLQELLNTRTNNFYVEGFDDNVITEMINMLCSE* |
| Ga0114356_13093631 | 3300008121 | Freshwater, Plankton | MKYFDVPLEHAWKVPVLQELLNTRMNNLYVEGFDDYV |
| Ga0114356_13206461 | 3300008121 | Freshwater, Plankton | YFDVPLEHAWKVPVLQELLNTRMNNLYVEGFDDYVIT* |
| Ga0114356_13270932 | 3300008121 | Freshwater, Plankton | MLDKKQMKYFDVPLDHAWKVPVLNEVINTRTNNLYVKGFDDYVITEMLNM* |
| Ga0114356_13371811 | 3300008121 | Freshwater, Plankton | MLVKKQMKYFDVPLKHEWKVPVLQELLSTRMNNLYVEGFDDYVITEMINMLC |
| Ga0114356_13373811 | 3300008121 | Freshwater, Plankton | MEYFDVPLDHAWKVPVLQELLNTRTNNLIDQGFDDYVITEMKNILCNK* |
| Ga0114356_13391133 | 3300008121 | Freshwater, Plankton | MKYFDVPLEHEWKVPVLQELLNTRMNNLYVEGFDDYVITGMINMLCNE* |
| Ga0114356_13501561 | 3300008121 | Freshwater, Plankton | DLSKMLVKKQIKYFDVPLEHEWKVLVLQELLSTRMNNLYVEGFDDYVITEIINMLGSE* |
| Ga0114356_13567362 | 3300008121 | Freshwater, Plankton | MLAKKQKKYFDVLLEHAWKVPVLQELLNTRMNNLYVEGFDIT* |
| Ga0114356_13573771 | 3300008121 | Freshwater, Plankton | VPLEHEWKVPVLQELLNTRMNNLYVEGFDDYIITEMINMLCNEY* |
| Ga0114356_13904712 | 3300008121 | Freshwater, Plankton | KYFDVPLEHEWKVPVLQELLSTRMNNLYVEGFDDYVIIEMINMLCSE* |
| Ga0114356_14137771 | 3300008121 | Freshwater, Plankton | LSKMLVKKQMKYFNVPLEHEWKVPVLQELLNTRMNNLYVEGFDDSMII* |
| Ga0114356_14266631 | 3300008121 | Freshwater, Plankton | LVKKQMKYFDVPLEHEWKVPVLQELLNTRMNNLYVEGFNDYVITEMINILCSE* |
| Ga0114356_14359902 | 3300008121 | Freshwater, Plankton | MIVSTSDLSKMLVKKQIKYFDVLLEHAWKVPVLQELLNTRINNLYDEGFDDYVITEMINMLCNE* |
| Ga0114356_14776531 | 3300008121 | Freshwater, Plankton | MLVKKQMKYFNIPLEHAWKASVLQELLNTRMNNLYVVGFDDYT* |
| Ga0114356_14815953 | 3300008121 | Freshwater, Plankton | MKYFDVPLEHAWKVPVLQELLNTRMNNLYVEGFDDYVI |
| Ga0114356_14871432 | 3300008121 | Freshwater, Plankton | MFDMKQLKYYDVPLEHAWKVPVLQELLNTRMNNLCVEGFDDYVITEMINMLCSE* |
| Ga0114356_14919072 | 3300008121 | Freshwater, Plankton | MLVKKQIKYFDVPLEHEWKVPVLQELLNTRMNDLYVEGFDDYVIIEMINML |
| Ga0114356_15269441 | 3300008121 | Freshwater, Plankton | KQMKYFDVPLEHEWKVPVLQELLNTRMNNLYVEGFDDYVITEMINMLCSE* |
| Ga0114356_15527851 | 3300008121 | Freshwater, Plankton | MLAKKQMKYFDVPLEHEWKVPVLQELLNTRINNFYVEGFDDYVTTKMINMLCNE* |
| Ga0114359_10957381 | 3300008122 | Freshwater, Plankton | MLVKKQIKYFDVPLEHAWKVPVLQELLNTRMNNLYVEGFDDYVITEMINMLCSE* |
| Ga0114361_10676981 | 3300008265 | Freshwater, Plankton | MLVKKQIKYFDVPLEHAWKVPVLQELLNTRMNNLYVEGFEDYVTTEMINMLCNE* |
| Ga0114361_11095771 | 3300008265 | Freshwater, Plankton | MKYFDVSLDHAWKVPILQELLNTRIKNLYIEGFHDYLIPEMINILGNE* |
| Ga0114361_11201302 | 3300008265 | Freshwater, Plankton | QMTYFDVPLEHEWKVPVLQELLNTRMDNLYVEGFDDYVITEKINMVCNE* |
| Ga0114361_11404761 | 3300008265 | Freshwater, Plankton | MKYFDVPLDHAWKVLVLQELLNTRMNNLYVEGFDDYVIT* |
| Ga0114361_11434352 | 3300008265 | Freshwater, Plankton | MKYVDVPLDHAWKVPVLQELLNTRMNNLYVEGFDDYVITEMINM |
| Ga0114361_11648321 | 3300008265 | Freshwater, Plankton | MKYFDVPLEHAWKVPVLQELLNTRMNNLYVEGFDDYVITEMINMLCSE* |
| Ga0114361_12237971 | 3300008265 | Freshwater, Plankton | MLVKKQMKYFDVLLNHAWKVPVLQEPLNTRTNNLCVEGFDDYVIT |
| Ga0114361_13176701 | 3300008265 | Freshwater, Plankton | MLVKKQMKYFDVPLDHAWKVPVLQEFLNTRMNNLYVEGFDDYVIT |
| Ga0114357_12986843 | 3300008966 | Freshwater, Plankton | MLVKKQMKYFDVPLDHAWKVPVLQELLNTRMNNLYVEGFDDYVITEMINMLC |
| Ga0114357_13069101 | 3300008966 | Freshwater, Plankton | MLVKKQMKYFDVLLDHAWKVPVLQELSNTIRNNSYVEGFDDYVITEMINMLCNE* |
| Ga0102892_10949181 | 3300009057 | Estuarine | MLVKKQMKYFDVPLDHAWKVPILQELLNTRMNNSYVEGVDDYMKTEMINMLFNE* |
| Ga0244776_109088881 | 3300024348 | Estuarine | MLVKKQMKYFNVPLDHAWKVPILQELLNTRMNNLYVEGFDDYMITEMINMLCNE |
| ⦗Top⦘ |