| Basic Information | |
|---|---|
| Taxon OID | 3300004090 Open in IMG/M |
| Scaffold ID | Ga0064458_1003545 Open in IMG/M |
| Source Dataset Name | Eurytemora affinis associated microbial communities from Braddock Bay, NY (Lake Ontario) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Maryland School of Medicine |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 925 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Arthropoda → Unclassified → Unclassified → Unclassified → Eurytemora Affinis Associated → Eurytemora Affinis Associated Microbial Communities From Braddock Bay, Ny (Lake Ontario) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Braddock Bay, NY, USA | |||||||
| Coordinates | Lat. (o) | 43.30746 | Long. (o) | -77.707341 | Alt. (m) | Depth (m) | 2 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F059702 | Metagenome | 133 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0064458_10035451 | F059702 | N/A | MKCFDVPLEHEWKVPVSQELLNTRMNNLYVEGFDDYVITEMINMLC |
| ⦗Top⦘ |