| Basic Information | |
|---|---|
| Taxon OID | 3300003535 Open in IMG/M |
| Scaffold ID | Ba1_1013457 Open in IMG/M |
| Source Dataset Name | Petroleum reservoir microbial communities from Reconcavo Basin, Brazil, analyzing oil degradation - Bahia-well BA- 1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2235 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Syntrophomonadaceae → Syntrophomonas → Syntrophomonas wolfei | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Unclassified → Unclassified → Unclassified → Petroleum Reservoir → Petroleum Reservoir Microbial Communities From Reconcavo Basin, Brazil, Analyzing Oil Degradation |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Brazil: State of Bahia | |||||||
| Coordinates | Lat. (o) | -12.2 | Long. (o) | -38.11 | Alt. (m) | Depth (m) | 500 to 1000 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F103105 | Metagenome / Metatranscriptome | 101 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ba1_10134574 | F103105 | AGGAGG | VIPAPYNSWPVVMSTNKAAQLLGVDRKTLAKNKNMLARCSETIGGKSKVIRDRLLRELKII* |
| ⦗Top⦘ |