Scaffold DC05A_1276760

Overview

Basic Information

• Taxon OID: 3300003458
• Scaffold ID: DC05A_1276760
• Source Dataset Name: Marine sediment microbial communities from Douglas Channel, Canada, that are oil-degrading - Sample S4-DC05A
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 577
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Sediment → Marine Sediment Microbial Communities From Douglas Channel, Canada, That Are Oil-Degrading

Source Dataset Sampling Location

• Location Name: Douglas Channel, British Columbia, Canada
• Coordinates
  • Lat. (^o): 53.6667
  • Long. (^o): -129.1333

Associated Families

Family	Category	Number of Sequences	3D Structure?
F062771	Metagenome	130	N

Sequences

Protein ID	Family	RBS	Sequence
DC05A_12767602	F062771	N/A	FRKKGFDTGGVKNSKLFEELATSSWNLAAGVETPERRHRSEPIGLFTNPSNLRGFKYPI*