| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300003458 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0111425 | Gp0104217 | Ga0059319 |
| Sample Name | Marine sediment microbial communities from Douglas Channel, Canada, that are oil-degrading - Sample S4-DC05A |
| Sequencing Status | Permanent Draft |
| Sequencing Center | |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 54900500 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1 | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Marine Sediment Microbial Communities From Douglas Channel, Canada, That Are Oil-Degrading |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Sediment → Marine Sediment Microbial Communities From Douglas Channel, Canada, That Are Oil-Degrading |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → marine neritic zone → marine sediment |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Sediment (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Douglas Channel, British Columbia, Canada | |||||||
| Coordinates | Lat. (o) | 53.6667 | Long. (o) | -129.1333 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F023593 | Metagenome / Metatranscriptome | 209 | N |
| F062771 | Metagenome | 130 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| DC05A_1103437 | Not Available | 502 | Open in IMG/M |
| DC05A_1276760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1 | 577 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| DC05A_1103437 | DC05A_11034372 | F023593 | MSKIKEIDELAQYQADVILETLKEQVEWSIADYDLSGDDYYNLRDYTVYQTVIKLLEQVDLVDVDYYKQNTIISG* |
| DC05A_1276760 | DC05A_12767602 | F062771 | FRKKGFDTGGVKNSKLFEELATSSWNLAAGVETPERRHRSEPIGLFTNPSNLRGFKYPI* |
| ⦗Top⦘ |