NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300003458

3300003458: Marine sediment microbial communities from Douglas Channel, Canada, that are oil-degrading - Sample S4-DC05A



Overview

Basic Information
IMG/M Taxon OID3300003458 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0111425 | Gp0104217 | Ga0059319
Sample NameMarine sediment microbial communities from Douglas Channel, Canada, that are oil-degrading - Sample S4-DC05A
Sequencing StatusPermanent Draft
Sequencing Center
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size54900500
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 11

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Sediment Microbial Communities From Douglas Channel, Canada, That Are Oil-Degrading
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Sediment → Marine Sediment Microbial Communities From Douglas Channel, Canada, That Are Oil-Degrading

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine neritic zonemarine sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Sediment (saline)

Location Information
LocationDouglas Channel, British Columbia, Canada
CoordinatesLat. (o)53.6667Long. (o)-129.1333Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F023593Metagenome / Metatranscriptome209N
F062771Metagenome130N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
DC05A_1103437Not Available502Open in IMG/M
DC05A_1276760All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1577Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
DC05A_1103437DC05A_11034372F023593MSKIKEIDELAQYQADVILETLKEQVEWSIADYDLSGDDYYNLRDYTVYQTVIKLLEQVDLVDVDYYKQNTIISG*
DC05A_1276760DC05A_12767602F062771FRKKGFDTGGVKNSKLFEELATSSWNLAAGVETPERRHRSEPIGLFTNPSNLRGFKYPI*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.