Basic Information | |
---|---|
IMG/M Taxon OID | 3300003458 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0111425 | Gp0104217 | Ga0059319 |
Sample Name | Marine sediment microbial communities from Douglas Channel, Canada, that are oil-degrading - Sample S4-DC05A |
Sequencing Status | Permanent Draft |
Sequencing Center | |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 54900500 |
Sequencing Scaffolds | 2 |
Novel Protein Genes | 2 |
Associated Families | 2 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Not Available | 1 |
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1 | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Marine Sediment Microbial Communities From Douglas Channel, Canada, That Are Oil-Degrading |
Type | Environmental |
Taxonomy | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Sediment → Marine Sediment Microbial Communities From Douglas Channel, Canada, That Are Oil-Degrading |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | marine biome → marine neritic zone → marine sediment |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Sediment (saline) |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Douglas Channel, British Columbia, Canada | |||||||
Coordinates | Lat. (o) | 53.6667 | Long. (o) | -129.1333 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F023593 | Metagenome / Metatranscriptome | 209 | N |
F062771 | Metagenome | 130 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
DC05A_1103437 | Not Available | 502 | Open in IMG/M |
DC05A_1276760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1 | 577 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
DC05A_1103437 | DC05A_11034372 | F023593 | MSKIKEIDELAQYQADVILETLKEQVEWSIADYDLSGDDYYNLRDYTVYQTVIKLLEQVDLVDVDYYKQNTIISG* |
DC05A_1276760 | DC05A_12767602 | F062771 | FRKKGFDTGGVKNSKLFEELATSSWNLAAGVETPERRHRSEPIGLFTNPSNLRGFKYPI* |
⦗Top⦘ |