Metagenome Family F062771

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F062771
Family Type	Metagenome
Number of Sequences	130
Average Sequence Length	42 residues
Representative Sequence	KGFDTGGVKNSKLFEELATSSWNLAAGVETPERGHRSEPI
Number of Associated Samples	46
Number of Associated Scaffolds	130

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	3.08 %
% of genes near scaffold ends (potentially truncated)	96.15 %
% of genes from short scaffolds (< 2000 bps)	70.00 %
Associated GOLD sequencing projects	43
AlphaFold2 3D model prediction	No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (74.615 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Marine → Strait → Unclassified → Seawater (22.308 % of family members)
Environment Ontology (ENVO)	Unclassified (34.615 % of family members)
Earth Microbiome Project Ontology (EMPO)	Unclassified (33.077 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 35.00% β-sheet: 0.00% Coil/Unstructured: 65.00%
Feature Viewer

Powered by Feature Viewer

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 130 Family Scaffolds
PF13286	HD_assoc	2.31
PF02574	S-methyl_trans	2.31
PF00795	CN_hydrolase	2.31
PF11898	DUF3418	2.31
PF00873	ACR_tran	1.54
PF05140	ResB	1.54
PF00905	Transpeptidase	1.54
PF00753	Lactamase_B	1.54
PF00072	Response_reg	1.54
PF00814	TsaD	1.54
PF02653	BPD_transp_2	1.54
PF13517	FG-GAP_3	1.54
PF13549	ATP-grasp_5	1.54
PF02518	HATPase_c	1.54
PF01075	Glyco_transf_9	1.54
PF16921	Tex_YqgF	1.54
PF03599	CdhD	0.77
PF01476	LysM	0.77
PF13424	TPR_12	0.77
PF07478	Dala_Dala_lig_C	0.77
PF12092	DUF3568	0.77
PF12146	Hydrolase_4	0.77
PF06414	Zeta_toxin	0.77
PF16363	GDP_Man_Dehyd	0.77
PF03454	MoeA_C	0.77
PF13186	SPASM	0.77
PF16576	HlyD_D23	0.77
PF01761	DHQ_synthase	0.77
PF00365	PFK	0.77
PF13458	Peripla_BP_6	0.77
PF07729	FCD	0.77
PF08328	ASL_C	0.77
PF00459	Inositol_P	0.77
PF14748	P5CR_dimer	0.77
PF12806	Acyl-CoA_dh_C	0.77
PF01039	Carboxyl_trans	0.77
PF13440	Polysacc_synt_3	0.77
PF13404	HTH_AsnC-type	0.77
PF00933	Glyco_hydro_3	0.77
PF00482	T2SSF	0.77
PF13229	Beta_helix	0.77
PF01171	ATP_bind_3	0.77
PF03641	Lysine_decarbox	0.77
PF03692	CxxCxxCC	0.77
PF00908	dTDP_sugar_isom	0.77
PF02801	Ketoacyl-synt_C	0.77
PF01734	Patatin	0.77
PF13857	Ank_5	0.77
PF07685	GATase_3	0.77
PF13185	GAF_2	0.77
PF00939	Na_sulph_symp	0.77
PF11734	TilS_C	0.77
PF02464	CinA	0.77
PF10502	Peptidase_S26	0.77
PF00857	Isochorismatase	0.77
PF01266	DAO	0.77
PF13366	PDDEXK_3	0.77
PF01012	ETF	0.77
PF00691	OmpA	0.77
PF08282	Hydrolase_3	0.77
PF00005	ABC_tran	0.77
PF13624	SurA_N_3	0.77
PF02540	NAD_synthase	0.77
PF00578	AhpC-TSA	0.77
PF00155	Aminotran_1_2	0.77
PF01979	Amidohydro_1	0.77
PF13561	adh_short_C2	0.77
PF00501	AMP-binding	0.77
PF08669	GCV_T_C	0.77
PF02769	AIRS_C	0.77
PF08734	GYD	0.77
PF12838	Fer4_7	0.77
PF04945	YHS	0.77
PF13671	AAA_33	0.77
PF03372	Exo_endo_phos	0.77
PF00012	HSP70	0.77
PF02586	SRAP	0.77
PF00300	His_Phos_1	0.77
PF00571	CBS	0.77
PF04055	Radical_SAM	0.77
PF01668	SmpB	0.77
PF13426	PAS_9	0.77
PF06245	DUF1015	0.77
PF13847	Methyltransf_31	0.77
PF06325	PrmA	0.77

COG ID	Name	Functional Category	% Frequency in 130 Family Scaffolds
COG2040	Homocysteine/selenocysteine methylase (S-methylmethionine-dependent)	Amino acid transport and metabolism [E]	2.31
COG0646	Methionine synthase I (cobalamin-dependent), methyltransferase domain	Amino acid transport and metabolism [E]	2.31
COG1333	Cytochrome c biogenesis protein ResB	Posttranslational modification, protein turnover, chaperones [O]	1.54
COG1214	tRNA A37 threonylcarbamoyladenosine modification protein TsaB	Translation, ribosomal structure and biogenesis [J]	1.54
COG0859	ADP-heptose:LPS heptosyltransferase	Cell wall/membrane/envelope biogenesis [M]	1.54
COG0533	tRNA A37 threonylcarbamoyltransferase TsaD	Translation, ribosomal structure and biogenesis [J]	1.54
COG2135	ssDNA abasic site-binding protein YedK/HMCES, SRAP family	Replication, recombination and repair [L]	0.77
COG1611	Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) family	Nucleotide transport and metabolism [F]	0.77
COG1752	Predicted acylesterase/phospholipase RssA, containd patatin domain	General function prediction only [R]	0.77
COG1802	DNA-binding transcriptional regulator, GntR family	Transcription [K]	0.77
COG1877	Trehalose-6-phosphate phosphatase	Carbohydrate transport and metabolism [G]	0.77
COG1898	dTDP-4-dehydrorhamnose 3,5-epimerase or related enzyme	Cell wall/membrane/envelope biogenesis [M]	0.77
COG2025	Electron transfer flavoprotein, alpha subunit FixB	Energy production and conversion [C]	0.77
COG2069	CO dehydrogenase/acetyl-CoA synthase delta subunit (corrinoid Fe-S protein)	Energy production and conversion [C]	0.77
COG2086	Electron transfer flavoprotein, alpha and beta subunits	Energy production and conversion [C]	0.77
COG1472	Periplasmic beta-glucosidase and related glycosidases	Carbohydrate transport and metabolism [G]	0.77
COG2186	DNA-binding transcriptional regulator, FadR family	Transcription [K]	0.77
COG2217	Cation-transporting P-type ATPase	Inorganic ion transport and metabolism [P]	0.77
COG2264	Ribosomal protein L11 methylase PrmA	Translation, ribosomal structure and biogenesis [J]	0.77
COG2890	Methylase of polypeptide chain release factors	Translation, ribosomal structure and biogenesis [J]	0.77
COG3621	Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR	General function prediction only [R]	0.77
COG3769	Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamily	Carbohydrate transport and metabolism [G]	0.77
COG3897	Protein N-terminal and lysine N-methylase, NNT1/EFM7 family	Posttranslational modification, protein turnover, chaperones [O]	0.77
COG4198	Uncharacterized conserved protein, DUF1015 family	Function unknown [S]	0.77
COG4274	Uncharacterized conserved protein, contains GYD domain	Function unknown [S]	0.77
COG4667	Predicted phospholipase, patatin/cPLA2 family	Lipid transport and metabolism [I]	0.77
COG4799	Acetyl-CoA carboxylase, carboxyltransferase component	Lipid transport and metabolism [I]	0.77
COG0561	Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases	Coenzyme transport and metabolism [H]	0.77
COG0037	tRNA(Ile)-lysidine synthase TilS/MesJ	Translation, ribosomal structure and biogenesis [J]	0.77
COG0171	NH3-dependent NAD+ synthetase	Coenzyme transport and metabolism [H]	0.77
COG0205	6-phosphofructokinase	Carbohydrate transport and metabolism [G]	0.77
COG0301	Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis)	Translation, ribosomal structure and biogenesis [J]	0.77
COG0303	Molybdopterin Mo-transferase (molybdopterin biosynthesis)	Coenzyme transport and metabolism [H]	0.77
COG0443	Molecular chaperone DnaK (HSP70)	Posttranslational modification, protein turnover, chaperones [O]	0.77
COG0471	Di- and tricarboxylate antiporter	Carbohydrate transport and metabolism [G]	0.77
COG0482	tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain	Translation, ribosomal structure and biogenesis [J]	0.77
COG0519	GMP synthase, PP-ATPase domain/subunit	Nucleotide transport and metabolism [F]	0.77
COG0560	Phosphoserine phosphatase	Amino acid transport and metabolism [E]	0.77
COG1606	ATP-utilizing enzyme, PP-loop superfamily	General function prediction only [R]	0.77
COG0603	7-cyano-7-deazaguanine synthase (queuosine biosynthesis)	Translation, ribosomal structure and biogenesis [J]	0.77
COG0691	tmRNA-binding protein	Posttranslational modification, protein turnover, chaperones [O]	0.77
COG0777	Acetyl-CoA carboxylase beta subunit	Lipid transport and metabolism [I]	0.77
COG0825	Acetyl-CoA carboxylase alpha subunit	Lipid transport and metabolism [I]	0.77
COG1055	Na+/H+ antiporter NhaD or related arsenite permease	Inorganic ion transport and metabolism [P]	0.77
COG1335	Nicotinamidase-related amidase	Coenzyme transport and metabolism [H]	0.77
COG1456	CO dehydrogenase/acetyl-CoA synthase gamma subunit (corrinoid Fe-S protein)	Energy production and conversion [C]	0.77
COG0015	Adenylosuccinate lyase	Nucleotide transport and metabolism [F]	0.77
COG1535	Isochorismate hydrolase	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.77
COG1546	Nicotinamide mononucleotide (NMN) deamidase PncC	Coenzyme transport and metabolism [H]	0.77

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	74.62 %
Unclassified	root	N/A	25.38 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	74.62 %
Unclassified	root	N/A	25.38 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	74.62 %
Unclassified	root	N/A	25.38 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	53.08 %
Unclassified	root	N/A	25.38 %
Spirochaetes	phylum	All Organisms → cellular organisms → Bacteria → Spirochaetes	6.15 %

Name	Rank	Taxonomy	Distribution
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	49.23 %
Unclassified	root	N/A	25.38 %
Spirochaetia	class	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia	6.15 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.77 %

Name	Rank	Taxonomy	Distribution
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	49.23 %
Unclassified	root	N/A	25.38 %
Spirochaetales	order	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales	6.15 %
Oceanospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales	0.77 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	25.38 %
Desulfobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales	18.46 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	6.92 %
Spirochaetaceae	family	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae	6.15 %
Saccharospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Saccharospirillaceae	0.77 %
Syntrophobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales	0.77 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	25.38 %
Desulfobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	10.00 %
unclassified Desulfobacterales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales	5.38 %
Alkalispirochaeta	genus	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta	4.62 %
Olavius sp. associated proteobacterium Delta 1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1	2.31 %
Deltaproteobacteria bacterium SG8_13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium SG8_13	1.54 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.54 %
Spirochaeta	genus	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Spirochaeta	1.54 %
Desulfobacterales incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis	0.77 %
Olavius algarvensis associated proteobacterium Delta 3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis associated proteobacterium Delta 3	0.77 %
Olavius algarvensis Delta 1 endosymbiont	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont	0.77 %
Saccharospirillum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Saccharospirillaceae → Saccharospirillum	0.77 %
Syntrophaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae	0.77 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	25.38 %
Desulfobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium	5.38 %
Alkalispirochaeta odontotermitis	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta → Alkalispirochaeta odontotermitis	4.62 %
Desulfosarcina	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina	2.31 %
Olavius sp. associated proteobacterium Delta 1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1	2.31 %
unclassified Desulfobacteraceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae	1.54 %
unclassified Spirochaeta	no rank	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Spirochaeta → unclassified Spirochaeta	1.54 %
Deltaproteobacteria bacterium SG8_13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium SG8_13	1.54 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.54 %
Candidatus Desulfatibia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia	0.77 %
unclassified Syntrophaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae	0.77 %
Olavius algarvensis associated proteobacterium Delta 3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis associated proteobacterium Delta 3	0.77 %
Olavius algarvensis Delta 1 endosymbiont	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont	0.77 %
Saccharospirillum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Saccharospirillaceae → Saccharospirillum	0.77 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	25.38 %
Desulfobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium	5.38 %
Alkalispirochaeta odontotermitis	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta → Alkalispirochaeta odontotermitis	4.62 %
Olavius sp. associated proteobacterium Delta 1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1	2.31 %
Desulfobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium	1.54 %
Spirochaeta sp.	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Spirochaeta → unclassified Spirochaeta → Spirochaeta sp.	1.54 %
Deltaproteobacteria bacterium SG8_13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium SG8_13	1.54 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.54 %
unclassified Desulfosarcina	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → unclassified Desulfosarcina	0.77 %
Syntrophaceae bacterium PtaU1.Bin231	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaU1.Bin231	0.77 %
Candidatus Desulfatibia profunda	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda	0.77 %
Olavius algarvensis associated proteobacterium Delta 3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis associated proteobacterium Delta 3	0.77 %
Olavius algarvensis Delta 1 endosymbiont	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont	0.77 %
Saccharospirillum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Saccharospirillaceae → Saccharospirillum	0.77 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	25.38 %
Desulfobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium	5.38 %
Alkalispirochaeta odontotermitis	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta → Alkalispirochaeta odontotermitis	4.62 %
Olavius sp. associated proteobacterium Delta 1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1	2.31 %
Desulfobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium	1.54 %
Spirochaeta sp.	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Spirochaeta → unclassified Spirochaeta → Spirochaeta sp.	1.54 %
Deltaproteobacteria bacterium SG8_13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium SG8_13	1.54 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.54 %
Desulfosarcina sp. BuS5	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → unclassified Desulfosarcina → Desulfosarcina sp. BuS5	0.77 %
Syntrophaceae bacterium PtaU1.Bin231	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaU1.Bin231	0.77 %
Candidatus Desulfatibia profunda	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda	0.77 %
Olavius algarvensis associated proteobacterium Delta 3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis associated proteobacterium Delta 3	0.77 %
Olavius algarvensis Delta 1 endosymbiont	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont	0.77 %
Saccharospirillum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Saccharospirillaceae → Saccharospirillum	0.77 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000118\|TDF_OR_ARG05_123mDRAFT_c1017239	Not Available	594	Open in IMG/M
3300000242\|TDF_OR_ARG05_123mDRAFT_1058696	Not Available	762	Open in IMG/M
3300003458\|DC05A_1276760	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1	577	Open in IMG/M
3300003769\|Ga0049118_10000006	All Organisms → cellular organisms → Bacteria → Proteobacteria	67161	Open in IMG/M
3300003769\|Ga0049118_10000090	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	28433	Open in IMG/M
3300003769\|Ga0049118_10010582	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	2361	Open in IMG/M
3300003843\|Ga0049117_10007643	Not Available	1905	Open in IMG/M
3300003944\|Ga0049119_1022576	Not Available	2781	Open in IMG/M
3300005588\|Ga0070728_10247067	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium	982	Open in IMG/M
3300005588\|Ga0070728_10336655	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	809	Open in IMG/M
3300005589\|Ga0070729_10293461	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	918	Open in IMG/M
3300005589\|Ga0070729_10516723	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	653	Open in IMG/M
3300005589\|Ga0070729_10610349	Not Available	591	Open in IMG/M
3300005589\|Ga0070729_10682406	Not Available	552	Open in IMG/M
3300005589\|Ga0070729_10746235	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	524	Open in IMG/M
3300005871\|Ga0056124_1000138	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	27133	Open in IMG/M
3300006467\|Ga0099972_10653324	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	676	Open in IMG/M
3300006467\|Ga0099972_10665693	Not Available	527	Open in IMG/M
3300006467\|Ga0099972_10903878	Not Available	620	Open in IMG/M
3300006467\|Ga0099972_12495056	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	1131	Open in IMG/M
3300006467\|Ga0099972_12827045	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda	1007	Open in IMG/M
3300006467\|Ga0099972_13242366	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	4860	Open in IMG/M
3300009035\|Ga0102958_1192352	Not Available	677	Open in IMG/M
3300010392\|Ga0118731_100624002	Not Available	1685	Open in IMG/M
3300010392\|Ga0118731_102097766	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1018	Open in IMG/M
3300010392\|Ga0118731_102927618	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	5164	Open in IMG/M
3300010392\|Ga0118731_103307068	Not Available	1455	Open in IMG/M
3300010392\|Ga0118731_105630482	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	2218	Open in IMG/M
3300010392\|Ga0118731_106327257	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales	5225	Open in IMG/M
3300010392\|Ga0118731_106334406	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales	936	Open in IMG/M
3300010392\|Ga0118731_106350666	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina	5383	Open in IMG/M
3300010392\|Ga0118731_106357592	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Spirochaeta → unclassified Spirochaeta → Spirochaeta sp.	3077	Open in IMG/M
3300010392\|Ga0118731_106361795	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	2087	Open in IMG/M
3300010392\|Ga0118731_106381122	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	3774	Open in IMG/M
3300010392\|Ga0118731_107214357	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis associated proteobacterium Delta 3	637	Open in IMG/M
3300010392\|Ga0118731_107706406	Not Available	813	Open in IMG/M
3300010392\|Ga0118731_108531878	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina	6100	Open in IMG/M
3300010392\|Ga0118731_108603719	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1443	Open in IMG/M
3300010392\|Ga0118731_109084447	All Organisms → cellular organisms → Bacteria	840	Open in IMG/M
3300010392\|Ga0118731_112616625	All Organisms → cellular organisms → Bacteria → Proteobacteria	3481	Open in IMG/M
3300010392\|Ga0118731_114908649	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Spirochaeta → unclassified Spirochaeta → Spirochaeta sp.	2364	Open in IMG/M
3300010430\|Ga0118733_100032880	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	11399	Open in IMG/M
3300010430\|Ga0118733_100112992	All Organisms → cellular organisms → Bacteria	5460	Open in IMG/M
3300010430\|Ga0118733_100136077	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	4913	Open in IMG/M
3300010430\|Ga0118733_100162846	Not Available	4444	Open in IMG/M
3300010430\|Ga0118733_100178133	All Organisms → cellular organisms → Bacteria	4226	Open in IMG/M
3300010430\|Ga0118733_100455083	Not Available	2539	Open in IMG/M
3300010430\|Ga0118733_101344513	All Organisms → cellular organisms → Bacteria	1425	Open in IMG/M
3300010430\|Ga0118733_101940148	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1	1171	Open in IMG/M
3300010430\|Ga0118733_103219483	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	891	Open in IMG/M
3300010430\|Ga0118733_104503228	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	743	Open in IMG/M
3300011262\|Ga0151668_1139904	All Organisms → cellular organisms → Bacteria → Proteobacteria	1332	Open in IMG/M
3300017990\|Ga0180436_10848597	All Organisms → cellular organisms → Bacteria	688	Open in IMG/M
3300022202\|Ga0224498_10167818	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	646	Open in IMG/M
3300022206\|Ga0224499_10034904	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta → Alkalispirochaeta odontotermitis	1623	Open in IMG/M
3300022206\|Ga0224499_10331783	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium SG8_13	513	Open in IMG/M
3300022220\|Ga0224513_10224149	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	740	Open in IMG/M
3300022308\|Ga0224504_10209186	All Organisms → cellular organisms → Bacteria	805	Open in IMG/M
(restricted) 3300022938\|Ga0233409_10033658	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1428	Open in IMG/M
(restricted) 3300024059\|Ga0255040_10418258	Not Available	569	Open in IMG/M
(restricted) 3300024062\|Ga0255039_10038027	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1783	Open in IMG/M
(restricted) 3300024062\|Ga0255039_10195166	Not Available	844	Open in IMG/M
(restricted) 3300024062\|Ga0255039_10457678	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	555	Open in IMG/M
(restricted) 3300024338\|Ga0255043_10007210	Not Available	2674	Open in IMG/M
(restricted) 3300024340\|Ga0255042_10117058	Not Available	764	Open in IMG/M
(restricted) 3300024340\|Ga0255042_10133566	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium	727	Open in IMG/M
(restricted) 3300024340\|Ga0255042_10254234	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium	566	Open in IMG/M
(restricted) 3300024340\|Ga0255042_10345431	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales	501	Open in IMG/M
(restricted) 3300024519\|Ga0255046_10026561	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium	2110	Open in IMG/M
(restricted) 3300024519\|Ga0255046_10031967	All Organisms → cellular organisms → Bacteria	1961	Open in IMG/M
(restricted) 3300024519\|Ga0255046_10115053	Not Available	1160	Open in IMG/M
(restricted) 3300024519\|Ga0255046_10147854	All Organisms → cellular organisms → Bacteria	1038	Open in IMG/M
(restricted) 3300024519\|Ga0255046_10157684	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	1009	Open in IMG/M
(restricted) 3300024519\|Ga0255046_10231255	All Organisms → cellular organisms → Bacteria	848	Open in IMG/M
(restricted) 3300024519\|Ga0255046_10297198	All Organisms → cellular organisms → Bacteria	753	Open in IMG/M
(restricted) 3300024519\|Ga0255046_10501792	Not Available	581	Open in IMG/M
(restricted) 3300024519\|Ga0255046_10613080	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium	524	Open in IMG/M
(restricted) 3300024519\|Ga0255046_10651037	Not Available	508	Open in IMG/M
(restricted) 3300024528\|Ga0255045_10049739	Not Available	1397	Open in IMG/M
(restricted) 3300024528\|Ga0255045_10052072	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium	1372	Open in IMG/M
(restricted) 3300024528\|Ga0255045_10073046	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1198	Open in IMG/M
(restricted) 3300024528\|Ga0255045_10153620	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	876	Open in IMG/M
(restricted) 3300024528\|Ga0255045_10159144	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	862	Open in IMG/M
(restricted) 3300024528\|Ga0255045_10263333	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium	686	Open in IMG/M
3300025883\|Ga0209456_10398046	Not Available	556	Open in IMG/M
3300027098\|Ga0209367_1019478	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	7784	Open in IMG/M
3300027175\|Ga0209146_1000206	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta → Alkalispirochaeta odontotermitis	19215	Open in IMG/M
3300027175\|Ga0209146_1000841	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	9477	Open in IMG/M
3300027175\|Ga0209146_1026438	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	3073	Open in IMG/M
3300027175\|Ga0209146_1038043	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	2586	Open in IMG/M
3300027828\|Ga0209692_10351657	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	639	Open in IMG/M
(restricted) 3300027837\|Ga0255041_10096375	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaU1.Bin231	977	Open in IMG/M
(restricted) 3300027837\|Ga0255041_10122900	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis Delta 1 endosymbiont	877	Open in IMG/M
(restricted) 3300027837\|Ga0255041_10147006	All Organisms → cellular organisms → Bacteria	809	Open in IMG/M
(restricted) 3300027837\|Ga0255041_10377642	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium SG8_13	520	Open in IMG/M
3300027845\|Ga0209271_10294430	Not Available	650	Open in IMG/M
(restricted) 3300027856\|Ga0255054_10086235	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Saccharospirillaceae → Saccharospirillum	1561	Open in IMG/M
3300027917\|Ga0209536_100027947	All Organisms → cellular organisms → Bacteria	7724	Open in IMG/M
3300027917\|Ga0209536_100059830	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	4950	Open in IMG/M
3300027917\|Ga0209536_100065983	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → unclassified Desulfosarcina → Desulfosarcina sp. BuS5	4679	Open in IMG/M
3300027917\|Ga0209536_100092960	All Organisms → cellular organisms → Bacteria	3850	Open in IMG/M
3300027917\|Ga0209536_100096008	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta → Alkalispirochaeta odontotermitis	3779	Open in IMG/M
3300027917\|Ga0209536_100214289	All Organisms → cellular organisms → Bacteria	2417	Open in IMG/M
3300027917\|Ga0209536_100352010	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1841	Open in IMG/M
(restricted) 3300027996\|Ga0233413_10067057	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1	1407	Open in IMG/M
3300028598\|Ga0265306_10003714	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta → Alkalispirochaeta odontotermitis	7351	Open in IMG/M
3300028598\|Ga0265306_10833264	Not Available	511	Open in IMG/M
3300028599\|Ga0265309_10052801	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium	2270	Open in IMG/M
3300028599\|Ga0265309_10161131	Not Available	1381	Open in IMG/M
3300028599\|Ga0265309_10644495	Not Available	715	Open in IMG/M
3300028600\|Ga0265303_10243158	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1390	Open in IMG/M
3300032251\|Ga0316198_10077485	All Organisms → cellular organisms → Bacteria	1981	Open in IMG/M
3300032252\|Ga0316196_10277586	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	731	Open in IMG/M
3300032252\|Ga0316196_10319262	All Organisms → cellular organisms → Bacteria	672	Open in IMG/M
3300032258\|Ga0316191_10068315	All Organisms → cellular organisms → Bacteria	2613	Open in IMG/M
3300032258\|Ga0316191_10166424	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta → Alkalispirochaeta odontotermitis	1611	Open in IMG/M
3300032258\|Ga0316191_10169593	All Organisms → cellular organisms → Bacteria	1595	Open in IMG/M
3300032258\|Ga0316191_10442780	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	945	Open in IMG/M
3300032258\|Ga0316191_10592543	All Organisms → cellular organisms → Bacteria → Proteobacteria	806	Open in IMG/M
3300032258\|Ga0316191_11004070	Not Available	604	Open in IMG/M
3300032259\|Ga0316190_10342270	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium	1020	Open in IMG/M
3300032260\|Ga0316192_10634290	All Organisms → cellular organisms → Bacteria	722	Open in IMG/M
3300032262\|Ga0316194_10078578	All Organisms → cellular organisms → Bacteria	2138	Open in IMG/M
3300032262\|Ga0316194_10102289	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta → Alkalispirochaeta odontotermitis	1850	Open in IMG/M
3300032262\|Ga0316194_10258900	Not Available	1108	Open in IMG/M
3300032262\|Ga0316194_10295799	Not Available	1028	Open in IMG/M
3300032262\|Ga0316194_10575551	Not Available	709	Open in IMG/M
3300032272\|Ga0316189_10875553	Not Available	682	Open in IMG/M
3300033429\|Ga0316193_10238907	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1439	Open in IMG/M
3300033429\|Ga0316193_11461020	Not Available	542	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	91.54%
Host-Associated	Host-Associated	8.46%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	90.77%
Annelida	Host-Associated → Annelida	8.46%
Terrestrial	Environmental → Terrestrial	0.77%

Habitat	Taxonomy	Distribution
Marine	Environmental → Aquatic → Marine	90.00%
Digestive System	Host-Associated → Annelida → Digestive System	8.46%
Non-Marine Saline And Alkaline	Environmental → Aquatic → Non-Marine Saline And Alkaline	0.77%
Soil	Environmental → Terrestrial → Soil	0.77%

Habitat	Taxonomy	Distribution
Coastal	Environmental → Aquatic → Marine → Coastal	48.46%
Strait	Environmental → Aquatic → Marine → Strait	22.31%
Unclassified	Host-Associated → Annelida → Digestive System → Unclassified	7.69%
Oceanic	Environmental → Aquatic → Marine → Oceanic	5.38%
Subtidal Zone	Environmental → Aquatic → Marine → Subtidal Zone	4.62%
Sediment	Environmental → Aquatic → Marine → Sediment	3.85%
Inlet	Environmental → Aquatic → Marine → Inlet	2.31%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	1.54%
Neritic Zone	Environmental → Aquatic → Marine → Neritic Zone	1.54%
Hypersaline	Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline	0.77%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.77%
Digestive Tube	Host-Associated → Annelida → Digestive System → Digestive Tube	0.77%

Habitat	Taxonomy	Distribution
Sediment	Environmental → Aquatic → Marine → Coastal → Sediment	47.69%
Unclassified	Environmental → Aquatic → Marine → Strait → Unclassified	22.31%
Unclassified	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified	7.69%
Sediment	Environmental → Aquatic → Marine → Oceanic → Sediment	5.38%
Sediment	Environmental → Aquatic → Marine → Subtidal Zone → Sediment	4.62%
Unclassified	Environmental → Aquatic → Marine → Sediment → Unclassified	3.85%
Unclassified	Environmental → Aquatic → Marine → Inlet → Unclassified	2.31%
Unclassified	Environmental → Aquatic → Marine → Neritic Zone → Unclassified	1.54%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	0.77%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	0.77%
Sediment	Environmental → Aquatic → Marine → Intertidal Zone → Sediment	0.77%
Sediment	Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment	0.77%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.77%
Extracellular Symbionts	Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts	0.77%

Habitat	Taxonomy	Distribution
Seawater	Environmental → Aquatic → Marine → Strait → Unclassified → Seawater	22.31%
Marine	Environmental → Aquatic → Marine → Coastal → Sediment → Marine	18.46%
Marine Sediment	Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment	14.62%
Sediment	Environmental → Aquatic → Marine → Coastal → Sediment → Sediment	7.69%
Marine Gutless Worms Symbiont	Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont	7.69%
Worm Burrow	Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow	6.92%
Marine Sediment	Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment	5.38%
Sediment	Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment	4.62%
Sediment	Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment	3.85%
Seawater	Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater	2.31%
Marine	Environmental → Aquatic → Marine → Coastal → Unclassified → Marine	0.77%
Marine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine	0.77%
Marine	Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine	0.77%
Pelagic Marine	Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine	0.77%
Marine Sediment	Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Sediment	0.77%
Hypersaline Lake Sediment	Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment	0.77%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.77%
Marine Gutless Worms Symbiont	Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts → Marine Gutless Worms Symbiont	0.77%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000118	Marine microbial communities from chronically polluted sediments in Tierra del Fuego - site OR sample ARG 06_12.3m	Environmental	Open in IMG/M
3300000242	Marine microbial communities from chronically polluted sediments in Tierra del Fuego: Site OR sample ARG 05_12.3m	Environmental	Open in IMG/M
3300003458	Marine sediment microbial communities from Douglas Channel, Canada, that are oil-degrading - Sample S4-DC05A	Environmental	Open in IMG/M
3300003769	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius geniculatus HERON ISLAND.2	Host-Associated	Open in IMG/M
3300003843	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius geniculatus HERON ISLAND.1	Host-Associated	Open in IMG/M
3300003944	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius geniculatus LIZARD ISLAND	Host-Associated	Open in IMG/M
3300005588	Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1	Environmental	Open in IMG/M
3300005589	Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2	Environmental	Open in IMG/M
3300005871	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. 4 HERON ISLAND	Host-Associated	Open in IMG/M
3300006467	Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935	Environmental	Open in IMG/M
3300009035	Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_D1_MG	Environmental	Open in IMG/M
3300010392	Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385	Environmental	Open in IMG/M
3300010430	Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples	Environmental	Open in IMG/M
3300011262	Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_5, total	Environmental	Open in IMG/M
3300017990	Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_S_2 metaG	Environmental	Open in IMG/M
3300022202	Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_21	Environmental	Open in IMG/M
3300022206	Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_24	Environmental	Open in IMG/M
3300022220	Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_21	Environmental	Open in IMG/M
3300022308	Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_24	Environmental	Open in IMG/M
3300022938 (restricted)	Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_13_MG	Environmental	Open in IMG/M
3300024059 (restricted)	Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2	Environmental	Open in IMG/M
3300024062 (restricted)	Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1	Environmental	Open in IMG/M
3300024338 (restricted)	Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_9	Environmental	Open in IMG/M
3300024340 (restricted)	Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_5	Environmental	Open in IMG/M
3300024519 (restricted)	Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27	Environmental	Open in IMG/M
3300024528 (restricted)	Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_23	Environmental	Open in IMG/M
3300025883	Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_11 (SPAdes)	Environmental	Open in IMG/M
3300027098	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius geniculatus LIZARD ISLAND.2 (SPAdes)	Host-Associated	Open in IMG/M
3300027175	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius geniculatus LIZARD ISLAND (SPAdes)	Host-Associated	Open in IMG/M
3300027828	Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 (SPAdes)	Environmental	Open in IMG/M
3300027837 (restricted)	Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_3	Environmental	Open in IMG/M
3300027845	Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 (SPAdes)	Environmental	Open in IMG/M
3300027856 (restricted)	Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_23	Environmental	Open in IMG/M
3300027917	Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)	Environmental	Open in IMG/M
3300027996 (restricted)	Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MG	Environmental	Open in IMG/M
3300028598	Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160420 (Illumina Assembly)	Environmental	Open in IMG/M
3300028599	Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160524 (Illumina Assembly)	Environmental	Open in IMG/M
3300028600	Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly)	Environmental	Open in IMG/M
3300032251	Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A anoxic	Environmental	Open in IMG/M
3300032252	Coastal sediment microbial communities from Maine, United States - Eddy sediment 2 cm	Environmental	Open in IMG/M
3300032258	Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 cm	Environmental	Open in IMG/M
3300032259	Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2	Environmental	Open in IMG/M
3300032260	Coastal sediment microbial communities from Maine, United States - Merrow Island worm burrow	Environmental	Open in IMG/M
3300032262	Coastal sediment microbial communities from Maine, United States - Cross River sediment 1	Environmental	Open in IMG/M
3300032272	Coastal sediment microbial communities from Maine, United States - Lowes Cove worm burrow	Environmental	Open in IMG/M
3300033429	Coastal sediment microbial communities from Maine, United States - Merrow Island sediment 2	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
TDF_OR_ARG05_123mDRAFT_10172392	3300000118	Marine	KGFDTGGVKNSKLFEELATSSWNLAAGVETPERRHRSEPI*
TDF_OR_ARG05_123mDRAFT_10586961	3300000242	Marine	KGFDTGGVKNSKLFEELATSSWNLAAGVETPERGHRSEPI*
DC05A_12767602	3300003458	Marine Sediment	FRKKGFDTGGVKNSKLFEELATSSWNLAAGVETPERRHRSEPIGLFTNPSNLRGFKYPI*
Ga0049118_100000069	3300003769	Marine Gutless Worms Symbiont	MGFDVGGVNPPEADKLFEELATSSWNLAAGSETPEKGHPNEPI*
Ga0049118_1000009024	3300003769	Marine Gutless Worms Symbiont	LGSDIAHFRGKGFDTGGVKNSKLFEELATSSWNLAAGVETPEKGHRSE
Ga0049118_100105821	3300003769	Marine Gutless Worms Symbiont	LGSDIAHFREKGFDPGGVKNSKLFEELATSSWNLAAGVETPEKGHRSE
Ga0049117_100076433	3300003843	Marine Gutless Worms Symbiont	LGSDIAHFREKGFDPGGVKNSKLFEELATSSWNLAAGVETPEKGHRR
Ga0049119_10225761	3300003944	Marine Gutless Worms Symbiont	LGSDIAHFRGKGFDTGGVKNFKLFEEHATSSWNLAAGVETPEKGHR
Ga0070728_102470671	3300005588	Marine Sediment	KKGFDTGGVKNSKLFEELATSSWNLDAGVQTPERGLRSEPI*
Ga0070728_103366551	3300005588	Marine Sediment	DTGGVNPPEADKLFEELATSSWNLAAGVQTSEKRHRSEPI*
Ga0070729_102934611	3300005589	Marine Sediment	RKKGFDTGGVKNSKLFEELATSSWNLVAGVQTPEKGHRSEPI*
Ga0070729_105167232	3300005589	Marine Sediment	DTGDVKNSKLFEELATSSWNLAAGVQTPETGHRSEPI*
Ga0070729_106103491	3300005589	Marine Sediment	TGGVKNSKLFEELATSSWNLAAGVETSEKGHRSESI*
Ga0070729_106824061	3300005589	Marine Sediment	LFRKKGFDTGGVKNSKLFEELATSSWNLAAGVQTPERRHRSEPI*
Ga0070729_107462352	3300005589	Marine Sediment	VSDIAPFGIRVFYTGGVKNSKLFEELATSSWNLAAGIETPEKGHRSEPI*
Ga0056124_100013819	3300005871	Marine Gutless Worms Symbiont	LGSDIAHFRGKGFDTGGVNPPEADKLFEELATSSWNLAAGIETPEKGHRSEPI*
Ga0099972_106533242	3300006467	Marine	CLFRKKGFDTGGVKNSKLFEELATSSWNLAAGVQTPERGLRSEPI*
Ga0099972_106656932	3300006467	Marine	DTGGVKNSKLFEELATSSWNLAAGVETPERGHRNEPI*
Ga0099972_109038782	3300006467	Marine	FIDSLVKVGLGSDIASFKKGFDTGGVKNSKLFEELATSSWNLATGVRTPERGHRSEPI*
Ga0099972_124950561	3300006467	Marine	PNWLAPVPPFGGLDTGGVKNSKLFEELATSSWNLAAGVQTPERGHRSEPI*
Ga0099972_128270452	3300006467	Marine	IGERHCPFRKKGFGTGGVKNSKLFEELATSSWNLAAGVETSEKGHRSESI*
Ga0099972_132423668	3300006467	Marine	RHCLFRKKGFDTGGVKNSKLFEELATSSWNLAAGVETPESGHRSEPI*
Ga0102958_11923521	3300009035	Soil	HCLFRKKGFDTGGVKNSKLFEELATSSWNLAAGVETPERRHRSEPI*
Ga0118731_1006240021	3300010392	Marine	GVKNSKLFEELATSSWNLAAGVQTPERGHRSEPI*
Ga0118731_1020977663	3300010392	Marine	CLFRKKGFDTGGVKNSKLFEELATSSWNLAPGVEIPERGHRSEPV*
Ga0118731_1029276181	3300010392	Marine	ERHCLFRKKGFDTGGVKNSKLFEELATSSWNLAAGVQTPERGLRSEPI*
Ga0118731_1033070681	3300010392	Marine	ERHCLFRKKGFDTGGVKNSKLFEELATSSWNLAAGVETPERGHRSEPI*
Ga0118731_1056304824	3300010392	Marine	TGGVNPPEADKLFEELATSSWNLAAGVQTPERGHRSEPI*
Ga0118731_1063272575	3300010392	Marine	GGVNPPEADKLFEELATSSWNLAAGVETPERGHRSEPI*
Ga0118731_1063344062	3300010392	Marine	GGVKNSKLFEELATSSWNLAAGVETSEKGHRSESI*
Ga0118731_1063506661	3300010392	Marine	GGVKNSKLFEELATSSWNLAAGVETPERGHRSEPI*
Ga0118731_1063575921	3300010392	Marine	GGVKNSKLFEELATSSWNLAAGVETPERGHRNEPI*
Ga0118731_1063617955	3300010392	Marine	GGVKNSKLFEELATSSWNLAAGVQTPERGHRSEPI*
Ga0118731_1063811223	3300010392	Marine	GGVKNSKLFEELATSSWNLAAGVQTPERRHRSEPI*
Ga0118731_1072143571	3300010392	Marine	VNPPEADKLFEELATSSWNLAAGVQTPERGHRSEPI*
Ga0118731_1077064061	3300010392	Marine	FDTGGVNPPEADKLFEELATSSWNLAAGVQTSEKRHRSEPI*
Ga0118731_1085318788	3300010392	Marine	GERHCLFRKKGFDTGGVKNSKLFEELATSSWNLAAGVETPESGHRSEPI*
Ga0118731_1086037193	3300010392	Marine	GVKNSKLFEELATSSWNLADGVETPERGHRSEPI*
Ga0118731_1090844471	3300010392	Marine	GVKNSKLFEELATSSWNLAAGVETPERGHRNEPI*
Ga0118731_1126166251	3300010392	Marine	KKGFDTGGVKNSKLFEELATSSWNLAAGVQTPERRHRSEPI*
Ga0118731_1149086491	3300010392	Marine	HCPFRKKGFDTGGVKNSKLFEELATSSWNLAAGVETPERGHRSKPI*
Ga0118733_10003288014	3300010430	Marine Sediment	GVKNSKLFEELATSSWNLAAGVETPERGHRSEPI*
Ga0118733_1001129921	3300010430	Marine Sediment	TGGVKNSKLFEELATSSWNLAAGVETPERGHRSEPI*
Ga0118733_1001360775	3300010430	Marine Sediment	FDTGGVKNSKLFEELATSSWNLAAGVETPERGHRSEPI*
Ga0118733_1001628461	3300010430	Marine Sediment	FRKKGFDTGDVKNSKLFEELATSSWNLAAGVQTPERRHRSEPI*
Ga0118733_1001781331	3300010430	Marine Sediment	ERHCLFRKKGFDTGGVKNSKLFEELATSSWNLDAGVQTPERGHRSEPI*
Ga0118733_1004550834	3300010430	Marine Sediment	PFRKKGFDTGGVKNSKLFEELATSSWNLAAGVETPERGHRSKPI*
Ga0118733_1013445132	3300010430	Marine Sediment	ERHCLFRKKGFDTGGVKNSKLFEELATSSWNLAAGVETPESGHRSEPI*
Ga0118733_1019401482	3300010430	Marine Sediment	GDVKNSKLFEELATSSWNLAAGVETPERRHRSEPI*
Ga0118733_1032194831	3300010430	Marine Sediment	ERHCRFRKKGFDTGGVNPPEADKLFEELATSSWNLVAGVQTPERGQQSEPI*
Ga0118733_1045032281	3300010430	Marine Sediment	KKGLDTGGVKNSKLFEELATSSWNLAAGVETPERGHRSETI*
Ga0151668_11399041	3300011262	Marine	FRKKGFGTGGVKNSKLFEELATSSWNLAAGVETPEKGHRSESI*
Ga0180436_108485971	3300017990	Hypersaline Lake Sediment	SDIGRFRKQSFASGGVKKPKLFEELATSSWDLAPGWETPETGRRSEPI
Ga0224498_101678181	3300022202	Sediment	GGVKNSKLFEELATSSWNLAAGVQTPERGHRSKPI
Ga0224499_100349041	3300022206	Sediment	FDTGGVKNSKLFEELATSSWNLAAGVETPERRHRSEPI
Ga0224499_103317832	3300022206	Sediment	CLFRKKGFDTGGVKNSKLFEELATSSWNLAAGVETPERRHRSEPI
Ga0224513_102241492	3300022220	Sediment	LRKKGFDTGGVKNSKLFEELATSSWNLAAGVATPERGHRS
Ga0224504_102091861	3300022308	Sediment	RHCLFRKKGFDTGGVKNSKLFEELATSSWNLAAGVETPERRHRSEPI
(restricted) Ga0233409_100336581	3300022938	Seawater	TGGVKNSKLFEELATSSWNLAAGVETPERGHRSEPI
(restricted) Ga0255040_104182581	3300024059	Seawater	RIGERHCLFRKKGFDTGGVKNSKLFEELATSSWNLAAGVETPERRHRSEPI
(restricted) Ga0255039_100380271	3300024062	Seawater	LPLSEKGFDTGGVKNSKLFEELATSSWNLAAGVQTPERRHRSEP
(restricted) Ga0255039_101951661	3300024062	Seawater	GGVKNSKLFEELATSSWNLAAGVETPERGHRSEPI
(restricted) Ga0255039_104576782	3300024062	Seawater	IGERHCLFRKKGFDTGGVNPPEADKLFEELATSSWNLAAGVETPERRHRSEPI
(restricted) Ga0255043_100072101	3300024338	Seawater	GGVKNSKLFEELATSSWNLAAGVQTPERGHRSESI
(restricted) Ga0255042_101170582	3300024340	Seawater	GGVKNSKLFEELATSSWNLAAGVETPERRHRSEPI
(restricted) Ga0255042_101335661	3300024340	Seawater	GGVKNSKLFEELATSSWNLVAGVETPERGHRSESI
(restricted) Ga0255042_102542342	3300024340	Seawater	KKGFDTGGVKNSKLFEELATSSWNLAAGVQTPEWGHRSEPI
(restricted) Ga0255042_103454311	3300024340	Seawater	PFRKKGFDTGGVKNSKLFEELATSSWNLAAGVQTPERGHRSKPI
(restricted) Ga0255046_100265612	3300024519	Seawater	DTGGVKNSKLFEELATSSWNLAAGVETPEWGHRSEPI
(restricted) Ga0255046_100319671	3300024519	Seawater	HCLFRKKGFDTGGVKNSKLFEELATSSWNLAAGVETPERRHRSEPI
(restricted) Ga0255046_101150533	3300024519	Seawater	GFDTGGVKNSKLFEELATSSWNLAAGVETPERGYRSEPI
(restricted) Ga0255046_101478541	3300024519	Seawater	HCLFRKKGFDTGGVNPPEADKLFEELATSSWNLAAGVQTPERRHRSEPI
(restricted) Ga0255046_101576842	3300024519	Seawater	CPFRKKGFDTGGVNPPEADKLFEELATSSWNLAAGVETPKRGHRSEPIGLFMNPS
(restricted) Ga0255046_102312551	3300024519	Seawater	KGFDTGGVKNSKLFEELATSSWNLAAGVETPERRHRSELI
(restricted) Ga0255046_102971982	3300024519	Seawater	ERHCRFRKKDFDTGGVKNSKLFEELATSSWNLAAGVEIPERGHRSEPI
(restricted) Ga0255046_105017921	3300024519	Seawater	VNPPEADKLFEELATSSWNLAAGVQTPERRHRSEPI
(restricted) Ga0255046_106130801	3300024519	Seawater	GFDTGGVNPPEADKLFEELATSSWNLAAGVQTPERGLRNEPI
(restricted) Ga0255046_106510371	3300024519	Seawater	HGLFRKKGFDIGGVNPPKADKLFEELATSSWNLAAGVQTPERGHRNEPI
(restricted) Ga0255045_100497391	3300024528	Seawater	TGAVMNSKLFEELATSSWNLAAGVQTPERGHRSKPI
(restricted) Ga0255045_100520722	3300024528	Seawater	NPPEADKLFEELATSSWNLAAGVETPEWGHRSEPI
(restricted) Ga0255045_100730461	3300024528	Seawater	RKKGFDTGGVNPPEADKLFEELATSSWNLAAGVETPERGHKSEPI
(restricted) Ga0255045_101536202	3300024528	Seawater	IGERHCLFRKKGFDTGGVNPPEADKLFEELATSSWNLVAGVETPERGHRSESI
(restricted) Ga0255045_101591442	3300024528	Seawater	DTGGVKNSKLFEELATSSWNLAAGVETPERGHRSKPI
(restricted) Ga0255045_102633331	3300024528	Seawater	RIRERHCLFRKKGFDTGGVKNSKLFEELATSSWNLVAEVETPERGHRSEPI
Ga0209456_103980461	3300025883	Pelagic Marine	LPLSEKGIDTGGVKNSKLFEELATSSWNLAAGIETPESRHRSEPI
Ga0209367_10194785	3300027098	Marine Gutless Worms Symbiont	MGFDVGGVNPPEADKLFEELATSSWNLAAGSETPEKGHPNEPI
Ga0209146_10002061	3300027175	Marine Gutless Worms Symbiont	GGVKNSKLFEELATSSWNLAAGVETPEKGHRSEPI
Ga0209146_10008413	3300027175	Marine Gutless Worms Symbiont	LGSDIAHFRGKGFDTGGVNPPEADKLFEELATSSWNLAAGIETPEKGHRSEPI
Ga0209146_10264381	3300027175	Marine Gutless Worms Symbiont	LGSDIAHFRGKGFDTGGVKNSKLFEELATSSWNLAAGVETPEKGHRS
Ga0209146_10380431	3300027175	Marine Gutless Worms Symbiont	LGSDIAHFREKGFDPGGVKNSKLFEELATSSWNLAAGVETPEKGHRS
Ga0209692_103516571	3300027828	Marine Sediment	DTGDVKNSKLFEELATSSWNLAAGVQTPETGHRSEPI
(restricted) Ga0255041_100963751	3300027837	Seawater	EKGFDAGGVKNSKLFEELATSSWNLVAGVQTPERGHRSEPI
(restricted) Ga0255041_101229001	3300027837	Seawater	DTGGVKNSKLFEELATSSWNLAAGVKTPERRHRSEPI
(restricted) Ga0255041_101470062	3300027837	Seawater	DTGGVKNSKLFEELATSSWNLAAGVETPERRHRSEPI
(restricted) Ga0255041_103776422	3300027837	Seawater	GGVKNSKLFEKLATSSWNLAAGIQTPERRHRSEPI
Ga0209271_102944302	3300027845	Marine Sediment	GFDTGGVKNSKLFEELATSSWNLAAGVETPERGHRNEPI
(restricted) Ga0255054_100862351	3300027856	Seawater	CLFRKKGFDTGGVKNSKLFEELATSSWNLAAGVQTPERGHRSEPI
Ga0209536_1000279471	3300027917	Marine Sediment	TGGVKNSKLFEELATRSWNLAAGVETPERGHRSEPI
Ga0209536_1000598301	3300027917	Marine Sediment	DTGGVKNSKLFEGLATSSWNLVAGVETPERGHRSEPI
Ga0209536_1000659838	3300027917	Marine Sediment	KGFDTGGVKNSKLFEELATSSWNLAAGVQTPERGHRSEPI
Ga0209536_1000929601	3300027917	Marine Sediment	KGFDTGGVKNSKLFEELATSSWNLVAGVETPERRHRSEPI
Ga0209536_1000960086	3300027917	Marine Sediment	KGFDTGGVNPPEADKLFEELATSSWNLVAGVETPERGHRSEPN
Ga0209536_1002142891	3300027917	Marine Sediment	KGFDTGGVKNSKLFEELATSSWNLAAGVQTPEKRHRSEPI
Ga0209536_1003520101	3300027917	Marine Sediment	KKGFDTGGVKNSKLFEELATRSWNLAAGVETPEGGHRSEPI
(restricted) Ga0233413_100670573	3300027996	Seawater	KKGFDTGGVNPPEADKLFEELATRSWNLAVGVETPEREHRSEPI
Ga0265306_100037148	3300028598	Sediment	TGGVKNSKLFEELATSSWNLAAGVETPERGHRNEPI
Ga0265306_108332642	3300028598	Sediment	TGGVKNSKLFEELAMSSWNLAAGVETPERGHRSEPI
Ga0265309_100528011	3300028599	Sediment	HCPFRKKGFDTGGVKNSKLFEELATSSWNLAAGVETPERGHRNEPI
Ga0265309_101611312	3300028599	Sediment	DTGGVKNSKLFEELATSSWNLVAGVETPERGHRSEPI
Ga0265309_106444952	3300028599	Sediment	HCPFRKKGFDTGGVKNSKLFEELATSSWNLAAGVETPERGHRSEPI
Ga0265303_102431581	3300028600	Sediment	GGVKNSKLFEELATSSWNLVAGVETPERGHRSEPI
Ga0316198_100774855	3300032251	Sediment	HCPLRKKGFDTGGVKNSKLFEELATSSWNLAAGVETPERRHRSEPI
Ga0316196_102775863	3300032252	Sediment	ERHCLFRKKGFDTGGVKNSKLFEELATSSWNLAAGVETPERGHRSEPI
Ga0316196_103192622	3300032252	Sediment	GFDTGGVKNSKLFEELATSSWNLAAGVQTPEKRHRSEPI
Ga0316191_100683151	3300032258	Worm Burrow	VNPPEADKLFEELATSSWNLAAGVATPERGHRSEPI
Ga0316191_101664243	3300032258	Worm Burrow	GGVKNSKLFEELATSSWNLAAGVQTPERGHRSEPI
Ga0316191_101695933	3300032258	Worm Burrow	FRKKGFDTGGVKNSKLFEELATSSWNSAAGVETPERGHPSEPI
Ga0316191_104427802	3300032258	Worm Burrow	IGERHCLFRKKGFDTGGVKNSKLFEELATSSWNLAAGVETPEKRHRSEPI
Ga0316191_105925432	3300032258	Worm Burrow	FRKKGFDTGGVKNSKLFEELATSSWNLAAGVQTPERGHRSEPI
Ga0316191_110040702	3300032258	Worm Burrow	GFDTGGVKNSKLFEELATSSWNLAVGVETPERGHRSELI
Ga0316190_103422701	3300032259	Worm Burrow	CLFRKKGFDTGGVKNSKLFEELATSSWNLAAGVETPEKRHRSEPI
Ga0316192_106342902	3300032260	Worm Burrow	DTGGVKNSKLFEELATSSWNLAAGVETPERRHRREPI
Ga0316194_100785784	3300032262	Sediment	HCLFRKKGFDTGGVKNSKLFEELATSSWNSAAGVETPERGHPSEPI
Ga0316194_101022891	3300032262	Sediment	FRKKGFDTGGVKNSKLFEELATSSWNLVAGVETPERRHRSEPI
Ga0316194_102589001	3300032262	Sediment	LFRKKGLDTGGVKNSKLFEELATSSWDLVAGGQTPERGHRSEPI
Ga0316194_102957991	3300032262	Sediment	LFRKKGFDTGGVKNSKLFEELATSSWNLAAGVKTPERGHRSEPI
Ga0316194_105755512	3300032262	Sediment	GGVKNSKLFEELATSSWNLAAGVQTPEKRHRSEPI
Ga0316189_108755531	3300032272	Worm Burrow	LFRKKGFDTGGVKNSKLFEELATSSWNLAAGIEIPERGHRSEPI
Ga0316193_102389071	3300033429	Sediment	FDTGGVNPPEADKLFEELATSSWNLAAGVETPERRHRSEPI
Ga0316193_114610201	3300033429	Sediment	CLFRKKGFDTGGVKNSKLFEALATSSWNLAAGVETPERGHRSEPI

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters