Scaffold JGI25160J50197_1101650

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI25160J50197_1101650

Scaffold JGI25160J50197_1101650

Overview

Basic Information
Taxon OID	3300003354 Open in IMG/M
Scaffold ID	JGI25160J50197_1101650 Open in IMG/M
Source Dataset Name	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	511
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere → Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations

Source Dataset Sampling Location
Location Name	University of North Carolina, USA
Coordinates	Lat. (^o)	35.9082	Long. (^o)	-79.0499	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F092682	Metagenome / Metatranscriptome	107	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI25160J50197_11016501	F092682	N/A	MHGRRQHXTAQKVRSSAAWRVCACIIDRSFVVIRLKHLAV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.