| Basic Information | |
|---|---|
| Family ID | F092682 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 107 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MHGLRQHMTAQKVRPSAAWRVCACIIDRSFVVIRLKHLAV |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 107 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 10.38 % |
| % of genes near scaffold ends (potentially truncated) | 16.82 % |
| % of genes from short scaffolds (< 2000 bps) | 88.79 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (52.336 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (21.495 % of family members) |
| Environment Ontology (ENVO) | Unclassified (42.991 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (53.271 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.12% β-sheet: 0.00% Coil/Unstructured: 55.88% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 107 Family Scaffolds |
|---|---|---|
| PF13840 | ACT_7 | 43.93 |
| PF13185 | GAF_2 | 25.23 |
| PF01590 | GAF | 11.21 |
| PF05524 | PEP-utilisers_N | 2.80 |
| PF13413 | HTH_25 | 1.87 |
| PF06676 | DUF1178 | 0.93 |
| PF00106 | adh_short | 0.93 |
| PF00291 | PALP | 0.93 |
| PF04551 | GcpE | 0.93 |
| COG ID | Name | Functional Category | % Frequency in 107 Family Scaffolds |
|---|---|---|---|
| COG0821 | 4-hydroxy-3-methylbut-2-enyl diphosphate synthase IspG/GcpE | Lipid transport and metabolism [I] | 0.93 |
| COG5319 | Uncharacterized conserved protein, DUF1178 domain | Function unknown [S] | 0.93 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 56.07 % |
| Unclassified | root | N/A | 43.93 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000156|NODE_c0641411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum | 2109 | Open in IMG/M |
| 3300000955|JGI1027J12803_100617880 | Not Available | 520 | Open in IMG/M |
| 3300003354|JGI25160J50197_1101650 | Not Available | 511 | Open in IMG/M |
| 3300004157|Ga0062590_101821453 | Not Available | 625 | Open in IMG/M |
| 3300004633|Ga0066395_10157902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1155 | Open in IMG/M |
| 3300005179|Ga0066684_10158919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 1439 | Open in IMG/M |
| 3300005290|Ga0065712_10710083 | Not Available | 542 | Open in IMG/M |
| 3300005328|Ga0070676_10411833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 943 | Open in IMG/M |
| 3300005331|Ga0070670_101124773 | Not Available | 717 | Open in IMG/M |
| 3300005335|Ga0070666_11107401 | Not Available | 589 | Open in IMG/M |
| 3300005353|Ga0070669_100955836 | Not Available | 734 | Open in IMG/M |
| 3300005364|Ga0070673_100708821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella massiliensis | 924 | Open in IMG/M |
| 3300005364|Ga0070673_101967463 | Not Available | 555 | Open in IMG/M |
| 3300005366|Ga0070659_100687703 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 884 | Open in IMG/M |
| 3300005435|Ga0070714_100808943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella massiliensis | 908 | Open in IMG/M |
| 3300005439|Ga0070711_101268019 | Not Available | 639 | Open in IMG/M |
| 3300005454|Ga0066687_10632407 | Not Available | 636 | Open in IMG/M |
| 3300005458|Ga0070681_10480977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella massiliensis | 1155 | Open in IMG/M |
| 3300005515|Ga0077122_10636259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 657 | Open in IMG/M |
| 3300005530|Ga0070679_100718705 | Not Available | 942 | Open in IMG/M |
| 3300005531|Ga0070738_10002485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 28271 | Open in IMG/M |
| 3300005535|Ga0070684_100898897 | Not Available | 830 | Open in IMG/M |
| 3300005548|Ga0070665_100051276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella massiliensis | 4138 | Open in IMG/M |
| 3300005548|Ga0070665_102007475 | Not Available | 584 | Open in IMG/M |
| 3300005560|Ga0066670_10396892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 845 | Open in IMG/M |
| 3300005562|Ga0058697_10216627 | Not Available | 876 | Open in IMG/M |
| 3300005615|Ga0070702_101499006 | Not Available | 555 | Open in IMG/M |
| 3300005718|Ga0068866_10919036 | Not Available | 617 | Open in IMG/M |
| 3300005841|Ga0068863_100274659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1632 | Open in IMG/M |
| 3300005841|Ga0068863_101700608 | Not Available | 640 | Open in IMG/M |
| 3300005981|Ga0081538_10042467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 2869 | Open in IMG/M |
| 3300006051|Ga0075364_10593694 | Not Available | 757 | Open in IMG/M |
| 3300006051|Ga0075364_11064126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 549 | Open in IMG/M |
| 3300006169|Ga0082029_1368250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 592 | Open in IMG/M |
| 3300006173|Ga0070716_100789772 | Not Available | 734 | Open in IMG/M |
| 3300006178|Ga0075367_10723016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 633 | Open in IMG/M |
| 3300006237|Ga0097621_102021781 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 551 | Open in IMG/M |
| 3300006755|Ga0079222_10655989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 817 | Open in IMG/M |
| 3300006854|Ga0075425_102572447 | Not Available | 563 | Open in IMG/M |
| 3300006871|Ga0075434_102571638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 510 | Open in IMG/M |
| 3300006904|Ga0075424_101779761 | Not Available | 652 | Open in IMG/M |
| 3300006931|Ga0097620_100268279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1799 | Open in IMG/M |
| 3300006954|Ga0079219_12330608 | Not Available | 518 | Open in IMG/M |
| 3300009101|Ga0105247_10479614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 902 | Open in IMG/M |
| 3300009148|Ga0105243_12380613 | Not Available | 568 | Open in IMG/M |
| 3300009148|Ga0105243_12458147 | Not Available | 560 | Open in IMG/M |
| 3300009174|Ga0105241_11683913 | Not Available | 616 | Open in IMG/M |
| 3300009176|Ga0105242_12203863 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 596 | Open in IMG/M |
| 3300009551|Ga0105238_10600116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 1109 | Open in IMG/M |
| 3300009609|Ga0105347_1448275 | Not Available | 558 | Open in IMG/M |
| 3300010358|Ga0126370_12035776 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300010360|Ga0126372_11044064 | Not Available | 832 | Open in IMG/M |
| 3300010361|Ga0126378_10775138 | Not Available | 1069 | Open in IMG/M |
| 3300010362|Ga0126377_12251520 | Not Available | 621 | Open in IMG/M |
| 3300010373|Ga0134128_12616716 | Not Available | 556 | Open in IMG/M |
| 3300010401|Ga0134121_12905963 | Not Available | 526 | Open in IMG/M |
| 3300012212|Ga0150985_109304655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus | 621 | Open in IMG/M |
| 3300012892|Ga0157294_10134057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus | 672 | Open in IMG/M |
| 3300012903|Ga0157289_10207334 | Not Available | 643 | Open in IMG/M |
| 3300012910|Ga0157308_10130325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 779 | Open in IMG/M |
| 3300012916|Ga0157310_10068980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus | 1069 | Open in IMG/M |
| 3300012943|Ga0164241_10270151 | Not Available | 1215 | Open in IMG/M |
| 3300012957|Ga0164303_10491383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 783 | Open in IMG/M |
| 3300012957|Ga0164303_11150820 | Not Available | 564 | Open in IMG/M |
| 3300012958|Ga0164299_10973617 | Not Available | 622 | Open in IMG/M |
| 3300012986|Ga0164304_10556547 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 848 | Open in IMG/M |
| 3300013296|Ga0157374_10439422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus | 1305 | Open in IMG/M |
| 3300014745|Ga0157377_10784725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus | 701 | Open in IMG/M |
| 3300014968|Ga0157379_12225074 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300014969|Ga0157376_12890774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus | 520 | Open in IMG/M |
| 3300015201|Ga0173478_10080154 | Not Available | 1153 | Open in IMG/M |
| 3300015374|Ga0132255_100616293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1606 | Open in IMG/M |
| 3300016294|Ga0182041_10936304 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 780 | Open in IMG/M |
| 3300017655|Ga0182739_1181163 | Not Available | 845 | Open in IMG/M |
| 3300018476|Ga0190274_10238740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus | 1637 | Open in IMG/M |
| 3300018476|Ga0190274_11689580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus | 727 | Open in IMG/M |
| 3300020027|Ga0193752_1004502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella massiliensis | 8962 | Open in IMG/M |
| 3300020081|Ga0206354_10969039 | Not Available | 816 | Open in IMG/M |
| 3300020146|Ga0196977_1106988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 646 | Open in IMG/M |
| 3300020193|Ga0194131_10016961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 7640 | Open in IMG/M |
| 3300021082|Ga0210380_10377366 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300021976|Ga0193742_1145895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus | 726 | Open in IMG/M |
| 3300025903|Ga0207680_10959621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 613 | Open in IMG/M |
| 3300025907|Ga0207645_10155763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 1493 | Open in IMG/M |
| 3300025912|Ga0207707_10329107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1318 | Open in IMG/M |
| 3300025916|Ga0207663_11477625 | Not Available | 547 | Open in IMG/M |
| 3300025925|Ga0207650_10391802 | Not Available | 1148 | Open in IMG/M |
| 3300025937|Ga0207669_11450713 | Not Available | 585 | Open in IMG/M |
| 3300025961|Ga0207712_10267838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1388 | Open in IMG/M |
| 3300027907|Ga0207428_11170758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 535 | Open in IMG/M |
| 3300028379|Ga0268266_12268007 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 514 | Open in IMG/M |
| 3300028381|Ga0268264_10057783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3246 | Open in IMG/M |
| 3300031366|Ga0307506_10127610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus | 867 | Open in IMG/M |
| 3300031716|Ga0310813_10062207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2789 | Open in IMG/M |
| 3300031716|Ga0310813_10097726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2276 | Open in IMG/M |
| 3300031716|Ga0310813_10858516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus | 820 | Open in IMG/M |
| 3300031716|Ga0310813_10892053 | Not Available | 805 | Open in IMG/M |
| 3300031908|Ga0310900_11063039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus | 668 | Open in IMG/M |
| 3300031939|Ga0308174_11051433 | Not Available | 692 | Open in IMG/M |
| 3300031944|Ga0310884_10674279 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 623 | Open in IMG/M |
| 3300032000|Ga0310903_10821003 | Not Available | 510 | Open in IMG/M |
| 3300032144|Ga0315910_10112397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus | 2006 | Open in IMG/M |
| 3300032211|Ga0310896_10311257 | Not Available | 817 | Open in IMG/M |
| 3300033412|Ga0310810_10075178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 4074 | Open in IMG/M |
| 3300033475|Ga0310811_10866864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus | 824 | Open in IMG/M |
| 3300033551|Ga0247830_11544970 | Not Available | 531 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 21.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 9.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.61% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.74% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.74% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.74% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.74% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.74% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 2.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.80% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.87% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.87% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.87% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.87% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.93% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.93% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.93% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.93% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.93% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.93% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.93% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.93% |
| Arabidopsis Root | Host-Associated → Plants → Roots → Endophytes → Unclassified → Arabidopsis Root | 0.93% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.93% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.93% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.93% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.93% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Host-Associated | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005515 | Combined assembly of arab plate scrape MF_Cvi (Combined Assembly) | Host-Associated | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
| 3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
| 3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
| 3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
| 3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300017655 | Enriched backyard soil microbial communities from Emeryville, California, USA - eDNA 5th pass 30_C BE-Lig BY (version 2) | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300020027 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c1 | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020146 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_10-13C | Environmental | Open in IMG/M |
| 3300020193 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120m | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021976 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c1 | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| NODE_06414112 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MHGTRHHLAATHARQSAGWRICACIIDRSFVVIRLKHLAV* |
| JGI1027J12803_1006178801 | 3300000955 | Soil | MHGLRQHMTAQNVRRSAAWRVCACIIDRSFVVIRLKH |
| JGI25160J50197_11016501 | 3300003354 | Arabidopsis Rhizosphere | MHGRRQHXTAQKVRSSAAWRVCACIIDRSFVVIRLKHLAV* |
| Ga0062590_1018214532 | 3300004157 | Soil | MRAKHAHMTCQNARRSAAAWRVCACIIDRSFVVIRLKHLAV* |
| Ga0066395_101579022 | 3300004633 | Tropical Forest Soil | MRAKRLHSTCQNARTPAAAWRACACVIDRSFVVIRLKHLAV* |
| Ga0066684_101589192 | 3300005179 | Soil | MHGARTQMASQNARFSAAWRAHFCAVGACIIDRSFVVIRLKHLAV* |
| Ga0065712_107100831 | 3300005290 | Miscanthus Rhizosphere | MRANHAHMTCQNTRRAAVWRVCACITDRSFVVIRLKHLAV* |
| Ga0070676_104118332 | 3300005328 | Miscanthus Rhizosphere | MHGLRHRMTVQHVRPSAAWRVCACIIDRSFVVIRLKHLAV* |
| Ga0070670_1011247732 | 3300005331 | Switchgrass Rhizosphere | MHGTCRQMTAQHVRRSAAWRVCACIIDRSFVVIRLKHLAV* |
| Ga0070666_111074011 | 3300005335 | Switchgrass Rhizosphere | MHGLRPQMTAKRARRSAAWRICACIIDRSFVVIRLKHPAV* |
| Ga0070669_1009558362 | 3300005353 | Switchgrass Rhizosphere | MYGTRNHMAATSARQSAAWRVCACIIDRSFVVIRLKHLAV* |
| Ga0070673_1007088212 | 3300005364 | Switchgrass Rhizosphere | MHGLRPQMTAQCARRSAAWRICACIIDRSFVVIRLKHPAV* |
| Ga0070673_1019674631 | 3300005364 | Switchgrass Rhizosphere | MYGTSNHMAATSARQSAAWRVCACIIDRSFVVIRLKHLAV* |
| Ga0070659_1006877032 | 3300005366 | Corn Rhizosphere | MHGTRNHLAATSPRQSAAWRVCACIIDRSFVVIRLKHLAV* |
| Ga0070714_1008089432 | 3300005435 | Agricultural Soil | MLGRRQHMTAQKVRPSAAWRVCACIIDRSFVVIRLKHLAV* |
| Ga0070711_1012680191 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | RRASCYKRAMHGLRQQMTARKVRPSAAWRVCACIIDRSFVVIRLKHLAV* |
| Ga0066687_106324071 | 3300005454 | Soil | MRGIRQQMTVRKVRPSAAWRVCACIIDRSFVVIRLKHLAV* |
| Ga0070681_104809772 | 3300005458 | Corn Rhizosphere | MRGLRQHMTAKTARRSAAWRVCACIIDRSFVVIRLKHLAV* |
| Ga0077122_106362592 | 3300005515 | Arabidopsis Root | MHGRRQHTTAQKVRSSAAWRVCACIIDRSFVVIRLKHLAV* |
| Ga0070679_1007187052 | 3300005530 | Corn Rhizosphere | MHGLRPQMTAQHACRSAAWRVCACIIDRSFVVIRLKHPAV* |
| Ga0070738_1000248519 | 3300005531 | Surface Soil | MLGRRQPMTAQKVRPSAAWRVCACIIDRSFVVIRLKHPAV* |
| Ga0070684_1008988972 | 3300005535 | Corn Rhizosphere | MRGLRQHMTAKTARPSAAWRVCACIIDRSFVVIRLKHLAV* |
| Ga0070665_1000512762 | 3300005548 | Switchgrass Rhizosphere | MQGARTHLAAINVRQSAAWRVCACIIDRCFVVIRLKHPAV* |
| Ga0070665_1020074751 | 3300005548 | Switchgrass Rhizosphere | MFGLRQHMTAKTARPSAAWRVGACIIDRSFVVIRLKHLAV* |
| Ga0066670_103968922 | 3300005560 | Soil | MHGARTQMACQNARFSAAWRAHFCAVGACIIDRSFVVIRLKHLAV* |
| Ga0058697_102166272 | 3300005562 | Agave | MRANHAHMTCQNARRAAVWRVCACIIDRSFVVIRLKHLAV* |
| Ga0070664_1004883172 | 3300005564 | Corn Rhizosphere | MRAKHARMTCQNARRSAAAWRVCACIIDRSFVVIRLKHLAV* |
| Ga0070702_1014990062 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MRANHARMTCQNARRAAVWRVCACITDRSFVVIRLKHLAV* |
| Ga0068866_109190362 | 3300005718 | Miscanthus Rhizosphere | RRTFCYNPAMHGTRNQLAAHSARRSAARRVCACIIDRSFVIIRLKHHAV* |
| Ga0068863_1002746592 | 3300005841 | Switchgrass Rhizosphere | MHGARTQFACQNALPALSAWRVCACIIDRSFVVIRLKHLAV* |
| Ga0068863_1017006082 | 3300005841 | Switchgrass Rhizosphere | MYGLRQHMIAQKVRPSAAWRVCACIIDRSFVVIRLKHLAV* |
| Ga0081538_100424671 | 3300005981 | Tabebuia Heterophylla Rhizosphere | HMTCQNARRAAVWRVCACITDRSFVVIRLKHLAV* |
| Ga0075364_105936941 | 3300006051 | Populus Endosphere | VRRASCYKRGMHGLRPQMTAQRARRPAAWRVCACIIDRSFVVIRLKHPAV* |
| Ga0075364_110641262 | 3300006051 | Populus Endosphere | MRAYHAHMTCQNTRRAAVWRVCACITDRSFVVIRLKHLAV* |
| Ga0082029_13682502 | 3300006169 | Termite Nest | MRANHAHMACQNTRRAAAWRVCACITDRSFVVIRLKHLAV* |
| Ga0070716_1007897721 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MHGLRQQMIAQNVRPSAAWRVCACIIDRSFVVIRLKHLAV* |
| Ga0075367_107230162 | 3300006178 | Populus Endosphere | MRAKHAHMTCQNARQSAAWRVCACITDRSFVVIRLKHLAV* |
| Ga0097621_1020217811 | 3300006237 | Miscanthus Rhizosphere | MRGTRQQMTVRQARRSAAWRVCACIIDRSFVVIRLKHLAV* |
| Ga0079222_106559892 | 3300006755 | Agricultural Soil | MRAKPAHMTCEKARQMAAAWRVCACVIDRSFVVIRLKHLAV* |
| Ga0075425_1025724471 | 3300006854 | Populus Rhizosphere | MRANHAHMTRQNARQSAAWRVCACITDRSFVVIRLKHLAV* |
| Ga0075434_1025716382 | 3300006871 | Populus Rhizosphere | MRADHARMTRQNARQSAAWRVCACITDRSFVVIRLKHLAV* |
| Ga0075424_1017797611 | 3300006904 | Populus Rhizosphere | MHGARTLLACQNAQPALSAWRVCACIIDRSFVVIRLKHLAV* |
| Ga0097620_1002682792 | 3300006931 | Switchgrass Rhizosphere | MHGLRPKMTAKRARQSAAWRICACIIDRSFVVIRLKHPAV* |
| Ga0079219_123306082 | 3300006954 | Agricultural Soil | MRADHAHTTCRNARRAADWRVCACIIDRSFVVIRLKHPAV* |
| Ga0105247_104796142 | 3300009101 | Switchgrass Rhizosphere | MRGIRQQMTVQKVRRSAAWRVCACIIDRSFVVIRLKHLAV* |
| Ga0105243_123806132 | 3300009148 | Miscanthus Rhizosphere | RTHMAANGARQSAAWRVCACIIDRSFVVIRLKHLAV* |
| Ga0105243_124581472 | 3300009148 | Miscanthus Rhizosphere | MHGLRPKMTAKRARQSAAWRICACIIDRSFVVIRLKHPAG* |
| Ga0105241_116839132 | 3300009174 | Corn Rhizosphere | TMHGLRQQMIAQKVRPSAAWRVCACIIDRSFVVIRLKHLAV* |
| Ga0105242_122038631 | 3300009176 | Miscanthus Rhizosphere | MRAKHAHMTCQNARRSAAAWRICACIIDRSFVVIRLKHLAV |
| Ga0105238_106001162 | 3300009551 | Corn Rhizosphere | MYGTRLQMAARTVRQSAAWRVCACIIDRSFVVIRLKHLAV* |
| Ga0105347_14482752 | 3300009609 | Soil | HGTRNHLAATSARQSAAWRVCACIIDRSFVVLRLKHLAV* |
| Ga0126370_120357762 | 3300010358 | Tropical Forest Soil | MRAKRLHSTCQNVRPAAAAWRVCACVIDRSFVVIRLKHPAV* |
| Ga0126372_110440642 | 3300010360 | Tropical Forest Soil | YKAHMHGARAQFACKTAHSAMPKAAAWRVCACIIDRSFVVIRLKHLAV* |
| Ga0126378_107751381 | 3300010361 | Tropical Forest Soil | MRANRLHSTCQNVRPAAAAWRVCACVIDRSFVVIRLKHLAV* |
| Ga0126377_122515201 | 3300010362 | Tropical Forest Soil | MRANRLHSTCQYVRTAAAAWRVCACIIDRSFVVIRLKHPAV* |
| Ga0134128_126167162 | 3300010373 | Terrestrial Soil | RRASCYKRDMHGLRPQMTAQHACRSAAWRVCACIIDRSFVVIRLKHPAV* |
| Ga0134121_129059632 | 3300010401 | Terrestrial Soil | MHGTRHEMAANHARRSAAWRVCACIIDRSFVVIRLKHLAA* |
| Ga0150985_1093046552 | 3300012212 | Avena Fatua Rhizosphere | MHGARTHLAATGVRQSAAWRICACIIDRSFVVIRLKHLAV* |
| Ga0157294_101340572 | 3300012892 | Soil | MHGTRNHLAATNARRSAAWRVCACIIDRSFVVIRLKHLAV* |
| Ga0157289_102073342 | 3300012903 | Soil | MHGLRQQMIAQKVRPSAAWRVCACIIDRSFVVIRLKHPAV* |
| Ga0157308_101303252 | 3300012910 | Soil | MHGLRQKMTAQRARRSAAWRVCACIIDRSFVVIRLKHLAV* |
| Ga0157310_100689802 | 3300012916 | Soil | MHGLRPKMTAQRARRSAAWRVCACIIDRSFVVIRLKHPAV* |
| Ga0164241_102701512 | 3300012943 | Soil | MHGTRNHLAATGARRSAAWRVCACIIDRSFVVIRLKHLAV* |
| Ga0164303_104913832 | 3300012957 | Soil | MLGRRQQMTAQKVRHSAAWRVCACIIDRSVVVIRLKHLAV* |
| Ga0164303_111508202 | 3300012957 | Soil | CYKRAMRGLRLHMIAQKVRPSAAWRVCACIIDRSFVVIRLKHLAV* |
| Ga0164299_109736172 | 3300012958 | Soil | MHGLRQHMTAKTARRSAAWRVCACIIDRSFVVIRLKHLAV* |
| Ga0164304_105565472 | 3300012986 | Soil | MHGTRHQMAANHARRSAAWRVCACIIDRSFVVIRLKHPAV* |
| Ga0157374_104394222 | 3300013296 | Miscanthus Rhizosphere | MLGRRQHMTAQKVRPSAAWRVCACMIDRSFVVIRLKHLAV* |
| Ga0157377_107847252 | 3300014745 | Miscanthus Rhizosphere | MHGLRQQMIAQKVRPSAAWRVCACIIDRSFVVIRLKHLAV* |
| Ga0157379_122250741 | 3300014968 | Switchgrass Rhizosphere | MHGTRNPMAANSACRSAVWRVCACIIDRSFVVIRLKHLA |
| Ga0157376_128907742 | 3300014969 | Miscanthus Rhizosphere | MHGTRNHLAATSARQSAAWRVCACIIDRSFVVIRLKHLAV* |
| Ga0173478_100801541 | 3300015201 | Soil | MHGTRTHMAANGARQSAAWRVCACIIDRSFVVIRLKHLAV* |
| Ga0132255_1006162932 | 3300015374 | Arabidopsis Rhizosphere | MHGLRQKMTAQRARRSAAWRVCACIIDRSFVVIRLKHPAV* |
| Ga0182041_109363042 | 3300016294 | Soil | MHGLRRHDMTAQKVRPSAAWRVCACIIDRSFVVIRLKHLAV |
| Ga0182739_11811631 | 3300017655 | Soil | MHRTRHYLAALSARQSAAWRVCACIIDRSFVVIRLKHPAA |
| Ga0190274_102387402 | 3300018476 | Soil | MHGTRNHLAATNARRSAAWRVCACIIDRSFVVIRLKHLAV |
| Ga0190274_116895802 | 3300018476 | Soil | MHGTRTHMAANGARQSAAWRVCACIIDRSFVVIRLKHLAV |
| Ga0193752_10045026 | 3300020027 | Soil | MHGTRNHLAATGARQSAAWRVCACIIDRSFVVIRLKHLAA |
| Ga0206354_109690392 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | LRQHMTAKTARRSAAWRVCACIIDRSFVVIRLKHLAA |
| Ga0196977_11069882 | 3300020146 | Soil | MHGLRQHMTAQKVRPSAAWRVCACIIDRSFVVIRLKHLAV |
| Ga0194131_100169613 | 3300020193 | Freshwater Lake | MRVAHAHTNCENARRSAAAWCVGARLIDRSFVVVRLKPPAV |
| Ga0210380_103773662 | 3300021082 | Groundwater Sediment | MHGLRPQMTAQCARRSAAWRICACIIDRSFVVIRLKHPAV |
| Ga0193742_11458952 | 3300021976 | Soil | MHGTRNHLAATSARQSAAWRVCACIIDRSFVVIRLKHLAV |
| Ga0207680_109596212 | 3300025903 | Switchgrass Rhizosphere | MHGLRPQMTAKRARRSAAWRICACIIDRSFVVIRLKHPAV |
| Ga0207645_101557632 | 3300025907 | Miscanthus Rhizosphere | MHGLRHRMTVQHVRPSAAWRVCACIIDRSFVVIRLKHLAV |
| Ga0207707_103291072 | 3300025912 | Corn Rhizosphere | MRGLRQHMTAKTARRSAAWRVCACIIDRSFVVIRLKHLAV |
| Ga0207663_114776252 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MHAARTQMACQNARFSAAWRVCACIIDRSFVVIRLKHLAV |
| Ga0207650_103918022 | 3300025925 | Switchgrass Rhizosphere | TCRQMTAQHVRRSAAWRVCACIIDRSFVVIRLKHLAV |
| Ga0207669_114507132 | 3300025937 | Miscanthus Rhizosphere | MHGLRPQMSAKRARRSAAWRVCACIIDRSFVVIRLKHLAV |
| Ga0207712_102678382 | 3300025961 | Switchgrass Rhizosphere | MYGTRNHMAATSARQSAAWRVCACIIDRSFVVIRLKHLAV |
| Ga0207428_111707582 | 3300027907 | Populus Rhizosphere | MHGLRPKMTAKRARQSAAWRICACIIDRSFVVIRLKHPAV |
| Ga0268266_122680072 | 3300028379 | Switchgrass Rhizosphere | MFGLRQHMTAKTARPSAAWRVGACIIDRSFVVIRLKHLAV |
| Ga0268264_100577832 | 3300028381 | Switchgrass Rhizosphere | MHGARTQIACQNALPALSAWRVCACIIDRSFVVIRLKHLAV |
| Ga0307506_101276102 | 3300031366 | Soil | MHGTRNSVAAMNDRRSAAWRVCACIIDRSFVVIRLKHLAV |
| Ga0310813_100622073 | 3300031716 | Soil | MHGLRPKMTAQRARRSAAWRVCACIIDRSFVVIRLKHPAV |
| Ga0310813_100977262 | 3300031716 | Soil | MYGRRQQMTAHNVRLSAAWRVCACIIDRSFVVIRLKHLAV |
| Ga0310813_108585162 | 3300031716 | Soil | MHGTCRQMTAQHVRRSAAWRVCACIIDRSFVVIRLKHLAV |
| Ga0310813_108920531 | 3300031716 | Soil | MYGLRQHMIAQKVRPSAAWRVCACIIDRSFVVIRLKHLAV |
| Ga0310900_110630392 | 3300031908 | Soil | MHGLRPKMTAQRARRSAAWRVCACIIDRSFVVIRLKHLAV |
| Ga0308174_110514332 | 3300031939 | Soil | MLGRRQSMTAQKVRHSAAWRVSACIIDRSFVVIRLKHLAV |
| Ga0310884_106742792 | 3300031944 | Soil | MHGLRPKMTAKRARQSAAWRICACIIDRSFVVIRL |
| Ga0310903_108210032 | 3300032000 | Soil | MHGTCRQMTAQHVRRSAAWRVCACIIDRSFVDIRLKHLAV |
| Ga0315910_101123972 | 3300032144 | Soil | MHGICRQMTAQHVRRSAAWRVCACIIDRSFVVIRLKHLAV |
| Ga0310896_103112571 | 3300032211 | Soil | MHGMRQHMIARKVRPSAAWRVCACIIDRSFVVIRLKHPAV |
| Ga0310810_100751784 | 3300033412 | Soil | MHGLRQKMTAQRARRSAAWRVCACIIDRSFVVIRLKHPAV |
| Ga0310811_108668642 | 3300033475 | Soil | MRGLRQHMTAKAARRSAAWRVCACIIDRSFVVIRLKHLAA |
| Ga0247830_115449702 | 3300033551 | Soil | GMRQHMIARKVRPSAAWRVCACIIDRSFVVIRLKHLAV |
| ⦗Top⦘ |