Metagenome / Metatranscriptome Family F092682

Overview

Basic Information

• Family ID: F092682
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 107
• Average Sequence Length: 41 residues
• Representative Sequence: MHGLRQHMTAQKVRPSAAWRVCACIIDRSFVVIRLKHLAV
• Number of Associated Samples: 97
• Number of Associated Scaffolds: 107

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 10.38 %
• % of genes near scaffold ends (potentially truncated): 16.82 %
• % of genes from short scaffolds (< 2000 bps): 88.79 %
• Associated GOLD sequencing projects: 91
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (52.336 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (21.495 % of family members)
• Environment Ontology (ENVO): Unclassified (42.991 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant rhizosphere (53.271 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 44.12%
  β-sheet: 0.00%
  Coil/Unstructured: 55.88%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 107 Family Scaffolds
PF13840	ACT_7	43.93
PF13185	GAF_2	25.23
PF01590	GAF	11.21
PF05524	PEP-utilisers_N	2.80
PF13413	HTH_25	1.87
PF06676	DUF1178	0.93
PF00106	adh_short	0.93
PF00291	PALP	0.93
PF04551	GcpE	0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 107 Family Scaffolds
COG0821	4-hydroxy-3-methylbut-2-enyl diphosphate synthase IspG/GcpE	Lipid transport and metabolism [I]	0.93
COG5319	Uncharacterized conserved protein, DUF1178 domain	Function unknown [S]	0.93

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	56.07 %
Unclassified	root	N/A	43.93 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	56.07 %
Unclassified	root	N/A	43.93 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	52.34 %
Unclassified	root	N/A	43.93 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	3.74 %

Level 4

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	49.53 %
Unclassified	root	N/A	43.93 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	2.80 %
Sar	clade	All Organisms → cellular organisms → Eukaryota → Sar	0.93 %

Level 5

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	47.66 %
Unclassified	root	N/A	43.93 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	2.80 %
Alveolata	clade	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata	0.93 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.93 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	28.97 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	18.69 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	2.80 %
Dinophyceae	class	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae	0.93 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.93 %
Hyphomicrobiales incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis	13.08 %
unclassified Rhodospirillales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales	7.48 %
Reyranellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae	4.67 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	2.80 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	0.93 %
Suessiales	order	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales	0.93 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.93 %
Enhydrobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter	13.08 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	6.54 %
Reyranella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella	4.67 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	2.80 %
Symbiodiniaceae	family	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae	0.93 %
Rhodospirillales bacterium URHD0017	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017	0.93 %
Magnetospirillum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum	0.93 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.93 %
Enhydrobacter aerosaccus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	13.08 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	6.54 %
Reyranella massiliensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella massiliensis	4.67 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	2.80 %
Symbiodinium	genus	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium	0.93 %
Rhodospirillales bacterium URHD0017	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017	0.93 %
Magnetospirillum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum	0.93 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.93 %
Enhydrobacter aerosaccus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	13.08 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	6.54 %
Reyranella massiliensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella massiliensis	4.67 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	2.80 %
Symbiodinium microadriaticum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	0.93 %
Rhodospirillales bacterium URHD0017	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017	0.93 %
Magnetospirillum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum	0.93 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.93 %
Enhydrobacter aerosaccus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	13.08 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	6.54 %
Reyranella massiliensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella massiliensis	4.67 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	2.80 %
Symbiodinium microadriaticum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	0.93 %
Rhodospirillales bacterium URHD0017	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017	0.93 %
Magnetospirillum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum	0.93 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.93 %
Enhydrobacter aerosaccus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	13.08 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	6.54 %
Reyranella massiliensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella massiliensis	4.67 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	2.80 %
Symbiodinium microadriaticum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	0.93 %
Rhodospirillales bacterium URHD0017	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017	0.93 %
Magnetospirillum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum	0.93 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.93 %
Enhydrobacter aerosaccus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	13.08 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	6.54 %
Reyranella massiliensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella massiliensis	4.67 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	2.80 %
Symbiodinium microadriaticum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	0.93 %
Rhodospirillales bacterium URHD0017	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017	0.93 %
Magnetospirillum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum	0.93 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.93 %
Enhydrobacter aerosaccus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	13.08 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	6.54 %
Reyranella massiliensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella massiliensis	4.67 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	2.80 %
Symbiodinium microadriaticum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	0.93 %
Rhodospirillales bacterium URHD0017	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017	0.93 %
Magnetospirillum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum	0.93 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.93 %
Enhydrobacter aerosaccus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	13.08 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	6.54 %
Reyranella massiliensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella massiliensis	4.67 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	2.80 %
Symbiodinium microadriaticum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	0.93 %
Rhodospirillales bacterium URHD0017	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017	0.93 %
Magnetospirillum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum	0.93 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.93 %
Enhydrobacter aerosaccus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	13.08 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	6.54 %
Reyranella massiliensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella massiliensis	4.67 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	2.80 %
Symbiodinium microadriaticum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	0.93 %
Rhodospirillales bacterium URHD0017	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017	0.93 %
Magnetospirillum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum	0.93 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.93 %
Enhydrobacter aerosaccus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	13.08 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	6.54 %
Reyranella massiliensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella massiliensis	4.67 %
fabids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids	2.80 %
Symbiodinium microadriaticum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	0.93 %
Rhodospirillales bacterium URHD0017	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017	0.93 %
Magnetospirillum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum	0.93 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.93 %
Enhydrobacter aerosaccus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	13.08 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	6.54 %
Reyranella massiliensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella massiliensis	4.67 %
Fabales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales	2.80 %
Symbiodinium microadriaticum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	0.93 %
Rhodospirillales bacterium URHD0017	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017	0.93 %
Magnetospirillum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum	0.93 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.93 %
Enhydrobacter aerosaccus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	13.08 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	6.54 %
Reyranella massiliensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella massiliensis	4.67 %
Fabaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae	2.80 %
Symbiodinium microadriaticum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	0.93 %
Rhodospirillales bacterium URHD0017	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017	0.93 %
Magnetospirillum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum	0.93 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.93 %
Enhydrobacter aerosaccus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	13.08 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	6.54 %
Reyranella massiliensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella massiliensis	4.67 %
Papilionoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae	2.80 %
Symbiodinium microadriaticum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	0.93 %
Rhodospirillales bacterium URHD0017	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017	0.93 %
Magnetospirillum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum	0.93 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.93 %
Enhydrobacter aerosaccus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	13.08 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	6.54 %
Reyranella massiliensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella massiliensis	4.67 %
50 kb inversion clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade	2.80 %
Symbiodinium microadriaticum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	0.93 %
Rhodospirillales bacterium URHD0017	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017	0.93 %
Magnetospirillum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum	0.93 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.93 %
Enhydrobacter aerosaccus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	13.08 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	6.54 %
Reyranella massiliensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella massiliensis	4.67 %
genistoids sensu lato	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato	2.80 %
Symbiodinium microadriaticum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	0.93 %
Rhodospirillales bacterium URHD0017	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017	0.93 %
Magnetospirillum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum	0.93 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.93 %
Enhydrobacter aerosaccus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	13.08 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	6.54 %
Reyranella massiliensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella massiliensis	4.67 %
core genistoids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids	2.80 %
Symbiodinium microadriaticum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	0.93 %
Rhodospirillales bacterium URHD0017	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017	0.93 %
Magnetospirillum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum	0.93 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.93 %
Enhydrobacter aerosaccus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	13.08 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	6.54 %
Reyranella massiliensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella massiliensis	4.67 %
Genisteae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae	2.80 %
Symbiodinium microadriaticum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	0.93 %
Rhodospirillales bacterium URHD0017	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017	0.93 %
Magnetospirillum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum	0.93 %

Level 25

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.93 %
Enhydrobacter aerosaccus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	13.08 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	6.54 %
Reyranella massiliensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella massiliensis	4.67 %
Lupinus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus	2.80 %
Symbiodinium microadriaticum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	0.93 %
Rhodospirillales bacterium URHD0017	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017	0.93 %
Magnetospirillum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum	0.93 %

Level 26

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	43.93 %
Enhydrobacter aerosaccus	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	13.08 %
Rhodospirillales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	6.54 %
Reyranella massiliensis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella massiliensis	4.67 %
Lupinus albus	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus	2.80 %
Symbiodinium microadriaticum	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	0.93 %
Rhodospirillales bacterium URHD0017	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017	0.93 %
Magnetospirillum	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum	0.93 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300000156|NODE_c0641411	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Magnetospirillum	2109
3300000955|JGI1027J12803_100617880	Not Available	520
3300003354|JGI25160J50197_1101650	Not Available	511
3300004157|Ga0062590_101821453	Not Available	625
3300004633|Ga0066395_10157902	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	1155
3300005179|Ga0066684_10158919	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	1439
3300005290|Ga0065712_10710083	Not Available	542
3300005328|Ga0070676_10411833	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	943
3300005331|Ga0070670_101124773	Not Available	717
3300005335|Ga0070666_11107401	Not Available	589
3300005353|Ga0070669_100955836	Not Available	734
3300005364|Ga0070673_100708821	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella massiliensis	924
3300005364|Ga0070673_101967463	Not Available	555
3300005366|Ga0070659_100687703	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	884
3300005435|Ga0070714_100808943	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella massiliensis	908
3300005439|Ga0070711_101268019	Not Available	639
3300005454|Ga0066687_10632407	Not Available	636
3300005458|Ga0070681_10480977	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella massiliensis	1155
3300005515|Ga0077122_10636259	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	657
3300005530|Ga0070679_100718705	Not Available	942
3300005531|Ga0070738_10002485	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	28271
3300005535|Ga0070684_100898897	Not Available	830
3300005548|Ga0070665_100051276	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella massiliensis	4138
3300005548|Ga0070665_102007475	Not Available	584
3300005560|Ga0066670_10396892	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	845
3300005562|Ga0058697_10216627	Not Available	876
3300005615|Ga0070702_101499006	Not Available	555
3300005718|Ga0068866_10919036	Not Available	617
3300005841|Ga0068863_100274659	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	1632
3300005841|Ga0068863_101700608	Not Available	640
3300005981|Ga0081538_10042467	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	2869
3300006051|Ga0075364_10593694	Not Available	757
3300006051|Ga0075364_11064126	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	549
3300006169|Ga0082029_1368250	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	592
3300006173|Ga0070716_100789772	Not Available	734
3300006178|Ga0075367_10723016	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	633
3300006237|Ga0097621_102021781	All Organisms → cellular organisms → Bacteria → Proteobacteria	551
3300006755|Ga0079222_10655989	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	817
3300006854|Ga0075425_102572447	Not Available	563
3300006871|Ga0075434_102571638	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	510
3300006904|Ga0075424_101779761	Not Available	652
3300006931|Ga0097620_100268279	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	1799
3300006954|Ga0079219_12330608	Not Available	518
3300009101|Ga0105247_10479614	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	902
3300009148|Ga0105243_12380613	Not Available	568
3300009148|Ga0105243_12458147	Not Available	560
3300009174|Ga0105241_11683913	Not Available	616
3300009176|Ga0105242_12203863	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus	596
3300009551|Ga0105238_10600116	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium	1109
3300009609|Ga0105347_1448275	Not Available	558
3300010358|Ga0126370_12035776	All Organisms → cellular organisms → Bacteria	562
3300010360|Ga0126372_11044064	Not Available	832
3300010361|Ga0126378_10775138	Not Available	1069
3300010362|Ga0126377_12251520	Not Available	621
3300010373|Ga0134128_12616716	Not Available	556
3300010401|Ga0134121_12905963	Not Available	526
3300012212|Ga0150985_109304655	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	621
3300012892|Ga0157294_10134057	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	672
3300012903|Ga0157289_10207334	Not Available	643
3300012910|Ga0157308_10130325	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	779
3300012916|Ga0157310_10068980	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	1069
3300012943|Ga0164241_10270151	Not Available	1215
3300012957|Ga0164303_10491383	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	783
3300012957|Ga0164303_11150820	Not Available	564
3300012958|Ga0164299_10973617	Not Available	622
3300012986|Ga0164304_10556547	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus	848
3300013296|Ga0157374_10439422	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	1305
3300014745|Ga0157377_10784725	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	701
3300014968|Ga0157379_12225074	All Organisms → cellular organisms → Bacteria	545
3300014969|Ga0157376_12890774	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	520
3300015201|Ga0173478_10080154	Not Available	1153
3300015374|Ga0132255_100616293	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	1606
3300016294|Ga0182041_10936304	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum	780
3300017655|Ga0182739_1181163	Not Available	845
3300018476|Ga0190274_10238740	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	1637
3300018476|Ga0190274_11689580	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	727
3300020027|Ga0193752_1004502	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella massiliensis	8962
3300020081|Ga0206354_10969039	Not Available	816
3300020146|Ga0196977_1106988	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	646
3300020193|Ga0194131_10016961	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	7640
3300021082|Ga0210380_10377366	All Organisms → cellular organisms → Bacteria	648
3300021976|Ga0193742_1145895	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	726
3300025903|Ga0207680_10959621	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	613
3300025907|Ga0207645_10155763	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017	1493
3300025912|Ga0207707_10329107	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	1318
3300025916|Ga0207663_11477625	Not Available	547
3300025925|Ga0207650_10391802	Not Available	1148
3300025937|Ga0207669_11450713	Not Available	585
3300025961|Ga0207712_10267838	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	1388
3300027907|Ga0207428_11170758	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	535
3300028379|Ga0268266_12268007	All Organisms → cellular organisms → Bacteria → Proteobacteria	514
3300028381|Ga0268264_10057783	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	3246
3300031366|Ga0307506_10127610	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	867
3300031716|Ga0310813_10062207	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	2789
3300031716|Ga0310813_10097726	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	2276
3300031716|Ga0310813_10858516	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	820
3300031716|Ga0310813_10892053	Not Available	805
3300031908|Ga0310900_11063039	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	668
3300031939|Ga0308174_11051433	Not Available	692
3300031944|Ga0310884_10674279	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus	623
3300032000|Ga0310903_10821003	Not Available	510
3300032144|Ga0315910_10112397	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	2006
3300032211|Ga0310896_10311257	Not Available	817
3300033412|Ga0310810_10075178	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	4074
3300033475|Ga0310811_10866864	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus	824
3300033551|Ga0247830_11544970	Not Available	531

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	56.07%
Host-Associated	Host-Associated	42.99%
Engineered	Engineered	0.93%

Class

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	53.27%
Plants	Host-Associated → Plants	42.99%
Aquatic	Environmental → Aquatic	2.80%
Solid Waste	Engineered → Solid Waste	0.93%

Category

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	53.27%
Rhizosphere	Host-Associated → Plants → Rhizosphere	28.04%
Rhizoplane	Host-Associated → Plants → Rhizoplane	8.41%
Roots	Host-Associated → Plants → Roots	5.61%
Freshwater	Environmental → Aquatic → Freshwater	1.87%
Sediment	Environmental → Aquatic → Sediment	0.93%
Phylloplane	Host-Associated → Plants → Phylloplane	0.93%
Grass	Engineered → Solid Waste → Grass	0.93%

Type

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	42.99%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	14.02%
Soil	Host-Associated → Plants → Rhizosphere → Soil	14.02%
Loam	Environmental → Terrestrial → Soil → Loam	9.35%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	5.61%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	2.80%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	2.80%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	1.87%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.93%
Lake	Environmental → Aquatic → Freshwater → Lake	0.93%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.93%
Sand	Environmental → Terrestrial → Soil → Sand	0.93%
Endophytes	Host-Associated → Plants → Roots → Endophytes	0.93%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified	0.93%
Composting	Engineered → Solid Waste → Grass → Composting	0.93%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	29.91%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	14.02%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	14.02%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	8.41%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	5.61%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	5.61%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	3.74%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	2.80%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	2.80%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	2.80%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.93%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	0.93%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.93%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	0.93%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	0.93%
Desert	Environmental → Terrestrial → Soil → Sand → Desert	0.93%
Unclassified	Host-Associated → Plants → Roots → Endophytes → Unclassified	0.93%
Unclassified	Host-Associated → Plants → Roots → Rhizosphere → Unclassified	0.93%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.93%
Unclassified	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified	0.93%
Bioreactor	Engineered → Solid Waste → Grass → Composting → Bioreactor	0.93%

Habitat

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	21.50%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	9.35%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	5.61%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	3.74%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	3.74%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	3.74%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	3.74%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	3.74%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	3.74%
Populus Endosphere	Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere	2.80%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.80%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.80%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	2.80%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.87%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.87%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.87%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.87%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	1.87%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	0.93%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	0.93%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	0.93%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	0.93%
Termite Nest	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest	0.93%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.93%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.93%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.93%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.93%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	0.93%
Soil	Environmental → Terrestrial → Soil → Sand → Desert → Soil	0.93%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.93%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere	0.93%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.93%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.93%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere	0.93%
Arabidopsis Root	Host-Associated → Plants → Roots → Endophytes → Unclassified → Arabidopsis Root	0.93%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere	0.93%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.93%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.93%
Agave	Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave	0.93%
Sugar Cane Bagasse Incubating Bioreactor	Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor	0.93%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300000156	Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic	Engineered
3300000955	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental
3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Host-Associated
3300004157	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2	Environmental
3300004633	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio	Environmental
3300005179	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133	Environmental
3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1	Host-Associated
3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Host-Associated
3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Host-Associated
3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Host-Associated
3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Host-Associated
3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Host-Associated
3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Host-Associated
3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Environmental
3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Environmental
3300005454	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136	Environmental
3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Environmental
3300005515	Combined assembly of arab plate scrape MF_Cvi (Combined Assembly)	Host-Associated
3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Environmental
3300005531	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2	Environmental
3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Environmental
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated
3300005560	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119	Environmental
3300005562	Agave microbial communities from Guanajuato, Mexico - As.Ma.e	Host-Associated
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated
3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Environmental
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated
3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Host-Associated
3300006051	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Host-Associated
3300006169	Termite nest microbial communities from Madurai, India	Environmental
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental
3300006178	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Host-Associated
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated
3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2)	Host-Associated
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated
3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Host-Associated
3300009609	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890	Environmental
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental
3300012212	Combined assembly of Hopland grassland soil	Host-Associated
3300012892	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1	Environmental
3300012903	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1	Environmental
3300012910	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2	Environmental
3300012916	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2	Environmental
3300012943	Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY)	Environmental
3300012957	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG	Environmental
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental
3300012986	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG	Environmental
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated
3300015201	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)	Environmental
3300015374	Col-0 rhizosphere combined assembly	Host-Associated
3300016294	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178	Environmental
3300017655	Enriched backyard soil microbial communities from Emeryville, California, USA - eDNA 5th pass 30_C BE-Lig BY (version 2)	Environmental
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental
3300020027	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c1	Environmental
3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)	Environmental
3300020146	Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_10-13C	Environmental
3300020193	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120m	Environmental
3300021082	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo	Environmental
3300021976	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c1	Environmental
3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)	Host-Associated
3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)	Host-Associated
3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)	Environmental
3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)	Environmental
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated
3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)	Host-Associated
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated
3300031366	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S	Environmental
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental
3300031908	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1	Environmental
3300031939	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2	Environmental
3300031944	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1	Environmental
3300032000	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3	Environmental
3300032144	Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil	Environmental
3300032211	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1	Environmental
3300033412	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC	Environmental
3300033475	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC	Environmental
3300033551	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
NODE_06414112	3300000156	Sugar Cane Bagasse Incubating Bioreactor	MHGTRHHLAATHARQSAGWRICACIIDRSFVVIRLKHLAV*
JGI1027J12803_1006178801	3300000955	Soil	MHGLRQHMTAQNVRRSAAWRVCACIIDRSFVVIRLKH
JGI25160J50197_11016501	3300003354	Arabidopsis Rhizosphere	MHGRRQHXTAQKVRSSAAWRVCACIIDRSFVVIRLKHLAV*
Ga0062590_1018214532	3300004157	Soil	MRAKHAHMTCQNARRSAAAWRVCACIIDRSFVVIRLKHLAV*
Ga0066395_101579022	3300004633	Tropical Forest Soil	MRAKRLHSTCQNARTPAAAWRACACVIDRSFVVIRLKHLAV*
Ga0066684_101589192	3300005179	Soil	MHGARTQMASQNARFSAAWRAHFCAVGACIIDRSFVVIRLKHLAV*
Ga0065712_107100831	3300005290	Miscanthus Rhizosphere	MRANHAHMTCQNTRRAAVWRVCACITDRSFVVIRLKHLAV*
Ga0070676_104118332	3300005328	Miscanthus Rhizosphere	MHGLRHRMTVQHVRPSAAWRVCACIIDRSFVVIRLKHLAV*
Ga0070670_1011247732	3300005331	Switchgrass Rhizosphere	MHGTCRQMTAQHVRRSAAWRVCACIIDRSFVVIRLKHLAV*
Ga0070666_111074011	3300005335	Switchgrass Rhizosphere	MHGLRPQMTAKRARRSAAWRICACIIDRSFVVIRLKHPAV*
Ga0070669_1009558362	3300005353	Switchgrass Rhizosphere	MYGTRNHMAATSARQSAAWRVCACIIDRSFVVIRLKHLAV*
Ga0070673_1007088212	3300005364	Switchgrass Rhizosphere	MHGLRPQMTAQCARRSAAWRICACIIDRSFVVIRLKHPAV*
Ga0070673_1019674631	3300005364	Switchgrass Rhizosphere	MYGTSNHMAATSARQSAAWRVCACIIDRSFVVIRLKHLAV*
Ga0070659_1006877032	3300005366	Corn Rhizosphere	MHGTRNHLAATSPRQSAAWRVCACIIDRSFVVIRLKHLAV*
Ga0070714_1008089432	3300005435	Agricultural Soil	MLGRRQHMTAQKVRPSAAWRVCACIIDRSFVVIRLKHLAV*
Ga0070711_1012680191	3300005439	Corn, Switchgrass And Miscanthus Rhizosphere	RRASCYKRAMHGLRQQMTARKVRPSAAWRVCACIIDRSFVVIRLKHLAV*
Ga0066687_106324071	3300005454	Soil	MRGIRQQMTVRKVRPSAAWRVCACIIDRSFVVIRLKHLAV*
Ga0070681_104809772	3300005458	Corn Rhizosphere	MRGLRQHMTAKTARRSAAWRVCACIIDRSFVVIRLKHLAV*
Ga0077122_106362592	3300005515	Arabidopsis Root	MHGRRQHTTAQKVRSSAAWRVCACIIDRSFVVIRLKHLAV*
Ga0070679_1007187052	3300005530	Corn Rhizosphere	MHGLRPQMTAQHACRSAAWRVCACIIDRSFVVIRLKHPAV*
Ga0070738_1000248519	3300005531	Surface Soil	MLGRRQPMTAQKVRPSAAWRVCACIIDRSFVVIRLKHPAV*
Ga0070684_1008988972	3300005535	Corn Rhizosphere	MRGLRQHMTAKTARPSAAWRVCACIIDRSFVVIRLKHLAV*
Ga0070665_1000512762	3300005548	Switchgrass Rhizosphere	MQGARTHLAAINVRQSAAWRVCACIIDRCFVVIRLKHPAV*
Ga0070665_1020074751	3300005548	Switchgrass Rhizosphere	MFGLRQHMTAKTARPSAAWRVGACIIDRSFVVIRLKHLAV*
Ga0066670_103968922	3300005560	Soil	MHGARTQMACQNARFSAAWRAHFCAVGACIIDRSFVVIRLKHLAV*
Ga0058697_102166272	3300005562	Agave	MRANHAHMTCQNARRAAVWRVCACIIDRSFVVIRLKHLAV*
Ga0070664_1004883172	3300005564	Corn Rhizosphere	MRAKHARMTCQNARRSAAAWRVCACIIDRSFVVIRLKHLAV*
Ga0070702_1014990062	3300005615	Corn, Switchgrass And Miscanthus Rhizosphere	MRANHARMTCQNARRAAVWRVCACITDRSFVVIRLKHLAV*
Ga0068866_109190362	3300005718	Miscanthus Rhizosphere	RRTFCYNPAMHGTRNQLAAHSARRSAARRVCACIIDRSFVIIRLKHHAV*
Ga0068863_1002746592	3300005841	Switchgrass Rhizosphere	MHGARTQFACQNALPALSAWRVCACIIDRSFVVIRLKHLAV*
Ga0068863_1017006082	3300005841	Switchgrass Rhizosphere	MYGLRQHMIAQKVRPSAAWRVCACIIDRSFVVIRLKHLAV*
Ga0081538_100424671	3300005981	Tabebuia Heterophylla Rhizosphere	HMTCQNARRAAVWRVCACITDRSFVVIRLKHLAV*
Ga0075364_105936941	3300006051	Populus Endosphere	VRRASCYKRGMHGLRPQMTAQRARRPAAWRVCACIIDRSFVVIRLKHPAV*
Ga0075364_110641262	3300006051	Populus Endosphere	MRAYHAHMTCQNTRRAAVWRVCACITDRSFVVIRLKHLAV*
Ga0082029_13682502	3300006169	Termite Nest	MRANHAHMACQNTRRAAAWRVCACITDRSFVVIRLKHLAV*
Ga0070716_1007897721	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	MHGLRQQMIAQNVRPSAAWRVCACIIDRSFVVIRLKHLAV*
Ga0075367_107230162	3300006178	Populus Endosphere	MRAKHAHMTCQNARQSAAWRVCACITDRSFVVIRLKHLAV*
Ga0097621_1020217811	3300006237	Miscanthus Rhizosphere	MRGTRQQMTVRQARRSAAWRVCACIIDRSFVVIRLKHLAV*
Ga0079222_106559892	3300006755	Agricultural Soil	MRAKPAHMTCEKARQMAAAWRVCACVIDRSFVVIRLKHLAV*
Ga0075425_1025724471	3300006854	Populus Rhizosphere	MRANHAHMTRQNARQSAAWRVCACITDRSFVVIRLKHLAV*
Ga0075434_1025716382	3300006871	Populus Rhizosphere	MRADHARMTRQNARQSAAWRVCACITDRSFVVIRLKHLAV*
Ga0075424_1017797611	3300006904	Populus Rhizosphere	MHGARTLLACQNAQPALSAWRVCACIIDRSFVVIRLKHLAV*
Ga0097620_1002682792	3300006931	Switchgrass Rhizosphere	MHGLRPKMTAKRARQSAAWRICACIIDRSFVVIRLKHPAV*
Ga0079219_123306082	3300006954	Agricultural Soil	MRADHAHTTCRNARRAADWRVCACIIDRSFVVIRLKHPAV*
Ga0105247_104796142	3300009101	Switchgrass Rhizosphere	MRGIRQQMTVQKVRRSAAWRVCACIIDRSFVVIRLKHLAV*
Ga0105243_123806132	3300009148	Miscanthus Rhizosphere	RTHMAANGARQSAAWRVCACIIDRSFVVIRLKHLAV*
Ga0105243_124581472	3300009148	Miscanthus Rhizosphere	MHGLRPKMTAKRARQSAAWRICACIIDRSFVVIRLKHPAG*
Ga0105241_116839132	3300009174	Corn Rhizosphere	TMHGLRQQMIAQKVRPSAAWRVCACIIDRSFVVIRLKHLAV*
Ga0105242_122038631	3300009176	Miscanthus Rhizosphere	MRAKHAHMTCQNARRSAAAWRICACIIDRSFVVIRLKHLAV
Ga0105238_106001162	3300009551	Corn Rhizosphere	MYGTRLQMAARTVRQSAAWRVCACIIDRSFVVIRLKHLAV*
Ga0105347_14482752	3300009609	Soil	HGTRNHLAATSARQSAAWRVCACIIDRSFVVLRLKHLAV*
Ga0126370_120357762	3300010358	Tropical Forest Soil	MRAKRLHSTCQNVRPAAAAWRVCACVIDRSFVVIRLKHPAV*
Ga0126372_110440642	3300010360	Tropical Forest Soil	YKAHMHGARAQFACKTAHSAMPKAAAWRVCACIIDRSFVVIRLKHLAV*
Ga0126378_107751381	3300010361	Tropical Forest Soil	MRANRLHSTCQNVRPAAAAWRVCACVIDRSFVVIRLKHLAV*
Ga0126377_122515201	3300010362	Tropical Forest Soil	MRANRLHSTCQYVRTAAAAWRVCACIIDRSFVVIRLKHPAV*
Ga0134128_126167162	3300010373	Terrestrial Soil	RRASCYKRDMHGLRPQMTAQHACRSAAWRVCACIIDRSFVVIRLKHPAV*
Ga0134121_129059632	3300010401	Terrestrial Soil	MHGTRHEMAANHARRSAAWRVCACIIDRSFVVIRLKHLAA*
Ga0150985_1093046552	3300012212	Avena Fatua Rhizosphere	MHGARTHLAATGVRQSAAWRICACIIDRSFVVIRLKHLAV*
Ga0157294_101340572	3300012892	Soil	MHGTRNHLAATNARRSAAWRVCACIIDRSFVVIRLKHLAV*
Ga0157289_102073342	3300012903	Soil	MHGLRQQMIAQKVRPSAAWRVCACIIDRSFVVIRLKHPAV*
Ga0157308_101303252	3300012910	Soil	MHGLRQKMTAQRARRSAAWRVCACIIDRSFVVIRLKHLAV*
Ga0157310_100689802	3300012916	Soil	MHGLRPKMTAQRARRSAAWRVCACIIDRSFVVIRLKHPAV*
Ga0164241_102701512	3300012943	Soil	MHGTRNHLAATGARRSAAWRVCACIIDRSFVVIRLKHLAV*
Ga0164303_104913832	3300012957	Soil	MLGRRQQMTAQKVRHSAAWRVCACIIDRSVVVIRLKHLAV*
Ga0164303_111508202	3300012957	Soil	CYKRAMRGLRLHMIAQKVRPSAAWRVCACIIDRSFVVIRLKHLAV*
Ga0164299_109736172	3300012958	Soil	MHGLRQHMTAKTARRSAAWRVCACIIDRSFVVIRLKHLAV*
Ga0164304_105565472	3300012986	Soil	MHGTRHQMAANHARRSAAWRVCACIIDRSFVVIRLKHPAV*
Ga0157374_104394222	3300013296	Miscanthus Rhizosphere	MLGRRQHMTAQKVRPSAAWRVCACMIDRSFVVIRLKHLAV*
Ga0157377_107847252	3300014745	Miscanthus Rhizosphere	MHGLRQQMIAQKVRPSAAWRVCACIIDRSFVVIRLKHLAV*
Ga0157379_122250741	3300014968	Switchgrass Rhizosphere	MHGTRNPMAANSACRSAVWRVCACIIDRSFVVIRLKHLA
Ga0157376_128907742	3300014969	Miscanthus Rhizosphere	MHGTRNHLAATSARQSAAWRVCACIIDRSFVVIRLKHLAV*
Ga0173478_100801541	3300015201	Soil	MHGTRTHMAANGARQSAAWRVCACIIDRSFVVIRLKHLAV*
Ga0132255_1006162932	3300015374	Arabidopsis Rhizosphere	MHGLRQKMTAQRARRSAAWRVCACIIDRSFVVIRLKHPAV*
Ga0182041_109363042	3300016294	Soil	MHGLRRHDMTAQKVRPSAAWRVCACIIDRSFVVIRLKHLAV
Ga0182739_11811631	3300017655	Soil	MHRTRHYLAALSARQSAAWRVCACIIDRSFVVIRLKHPAA
Ga0190274_102387402	3300018476	Soil	MHGTRNHLAATNARRSAAWRVCACIIDRSFVVIRLKHLAV
Ga0190274_116895802	3300018476	Soil	MHGTRTHMAANGARQSAAWRVCACIIDRSFVVIRLKHLAV
Ga0193752_10045026	3300020027	Soil	MHGTRNHLAATGARQSAAWRVCACIIDRSFVVIRLKHLAA
Ga0206354_109690392	3300020081	Corn, Switchgrass And Miscanthus Rhizosphere	LRQHMTAKTARRSAAWRVCACIIDRSFVVIRLKHLAA
Ga0196977_11069882	3300020146	Soil	MHGLRQHMTAQKVRPSAAWRVCACIIDRSFVVIRLKHLAV
Ga0194131_100169613	3300020193	Freshwater Lake	MRVAHAHTNCENARRSAAAWCVGARLIDRSFVVVRLKPPAV
Ga0210380_103773662	3300021082	Groundwater Sediment	MHGLRPQMTAQCARRSAAWRICACIIDRSFVVIRLKHPAV
Ga0193742_11458952	3300021976	Soil	MHGTRNHLAATSARQSAAWRVCACIIDRSFVVIRLKHLAV
Ga0207680_109596212	3300025903	Switchgrass Rhizosphere	MHGLRPQMTAKRARRSAAWRICACIIDRSFVVIRLKHPAV
Ga0207645_101557632	3300025907	Miscanthus Rhizosphere	MHGLRHRMTVQHVRPSAAWRVCACIIDRSFVVIRLKHLAV
Ga0207707_103291072	3300025912	Corn Rhizosphere	MRGLRQHMTAKTARRSAAWRVCACIIDRSFVVIRLKHLAV
Ga0207663_114776252	3300025916	Corn, Switchgrass And Miscanthus Rhizosphere	MHAARTQMACQNARFSAAWRVCACIIDRSFVVIRLKHLAV
Ga0207650_103918022	3300025925	Switchgrass Rhizosphere	TCRQMTAQHVRRSAAWRVCACIIDRSFVVIRLKHLAV
Ga0207669_114507132	3300025937	Miscanthus Rhizosphere	MHGLRPQMSAKRARRSAAWRVCACIIDRSFVVIRLKHLAV
Ga0207712_102678382	3300025961	Switchgrass Rhizosphere	MYGTRNHMAATSARQSAAWRVCACIIDRSFVVIRLKHLAV
Ga0207428_111707582	3300027907	Populus Rhizosphere	MHGLRPKMTAKRARQSAAWRICACIIDRSFVVIRLKHPAV
Ga0268266_122680072	3300028379	Switchgrass Rhizosphere	MFGLRQHMTAKTARPSAAWRVGACIIDRSFVVIRLKHLAV
Ga0268264_100577832	3300028381	Switchgrass Rhizosphere	MHGARTQIACQNALPALSAWRVCACIIDRSFVVIRLKHLAV
Ga0307506_101276102	3300031366	Soil	MHGTRNSVAAMNDRRSAAWRVCACIIDRSFVVIRLKHLAV
Ga0310813_100622073	3300031716	Soil	MHGLRPKMTAQRARRSAAWRVCACIIDRSFVVIRLKHPAV
Ga0310813_100977262	3300031716	Soil	MYGRRQQMTAHNVRLSAAWRVCACIIDRSFVVIRLKHLAV
Ga0310813_108585162	3300031716	Soil	MHGTCRQMTAQHVRRSAAWRVCACIIDRSFVVIRLKHLAV
Ga0310813_108920531	3300031716	Soil	MYGLRQHMIAQKVRPSAAWRVCACIIDRSFVVIRLKHLAV
Ga0310900_110630392	3300031908	Soil	MHGLRPKMTAQRARRSAAWRVCACIIDRSFVVIRLKHLAV
Ga0308174_110514332	3300031939	Soil	MLGRRQSMTAQKVRHSAAWRVSACIIDRSFVVIRLKHLAV
Ga0310884_106742792	3300031944	Soil	MHGLRPKMTAKRARQSAAWRICACIIDRSFVVIRL
Ga0310903_108210032	3300032000	Soil	MHGTCRQMTAQHVRRSAAWRVCACIIDRSFVDIRLKHLAV
Ga0315910_101123972	3300032144	Soil	MHGICRQMTAQHVRRSAAWRVCACIIDRSFVVIRLKHLAV
Ga0310896_103112571	3300032211	Soil	MHGMRQHMIARKVRPSAAWRVCACIIDRSFVVIRLKHPAV
Ga0310810_100751784	3300033412	Soil	MHGLRQKMTAQRARRSAAWRVCACIIDRSFVVIRLKHPAV
Ga0310811_108668642	3300033475	Soil	MRGLRQHMTAKAARRSAAWRVCACIIDRSFVVIRLKHLAA
Ga0247830_115449702	3300033551	Soil	GMRQHMIARKVRPSAAWRVCACIIDRSFVVIRLKHLAV