NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300003354

3300003354: Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS



Overview

Basic Information
IMG/M Taxon OID3300003354 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0053073 | Gp0061147 | Ga0007027
Sample NameArabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size265322457
Sequencing Scaffolds2
Novel Protein Genes4
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella soli1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameArabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations
TypeHost-Associated
TaxonomyHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere → Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Plant → Plant rhizosphere

Location Information
LocationUniversity of North Carolina, USA
CoordinatesLat. (o)35.9082Long. (o)-79.0499Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015908Metagenome / Metatranscriptome251Y
F092682Metagenome / Metatranscriptome107Y
F103371Metagenome101Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI25160J50197_1073319All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Reyranellaceae → Reyranella → Reyranella soli650Open in IMG/M
JGI25160J50197_1101650Not Available511Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI25160J50197_1000294JGI25160J50197_10002946F103371MSYDDWKTHNPDDDRCEFCGAAPWECRGGWQPNKCSGECGTGWRDPDHEYEKMRDEA*
JGI25160J50197_1001780JGI25160J50197_10017803F103371MSYDDWKTHNPDDDRCEFCGAAPWECRGGWQPNNCTGECGKGWRDPDHEYEKMRDEA*
JGI25160J50197_1073319JGI25160J50197_10733191F015908MRYMMIAAVLGMLASQAQAESKKYRSVLIPEKSVQACSGWGQTYTVDVSNGVLTLGVNYARRLFSAPVDSDGKIAASYKDPSGGILKFIALGNGEYELSNP
JGI25160J50197_1101650JGI25160J50197_11016501F092682MHGRRQHXTAQKVRSSAAWRVCACIIDRSFVVIRLKHLAV*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.