NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0051092_1000525

Scaffold Ga0051092_1000525


Overview

Basic Information
Taxon OID3300003151 Open in IMG/M
Scaffold IDGa0051092_1000525 Open in IMG/M
Source Dataset NameAlvinella pompejana epibiont microbial communities from the East Pacific Rise hydrothermal vent
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterSymBio Corporation
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)4484
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (60.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Annelida → Integument → Cuticle → Epibionts → Alvinella Pompejana Epibiont → Alvinella Pompejana Epibiont Microbial Communities From The East Pacific Rise Hydrothermal Vent

Source Dataset Sampling Location
Location NameEast Pacific Rise
CoordinatesLat. (o)9.8344Long. (o)-104.2844Alt. (m)Depth (m)2500
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F088984Metagenome / Metatranscriptome109Y

Sequences

Protein IDFamilyRBSSequence
Ga0051092_10005259F088984N/AMIAFFRSPSISLWWAHVTDTPDARRTAVFRRGTANGSRGVIPGGGQLQPISGVGDNLLWKNAQKILMKNITSEAMKKIIPQRSPWATTEV*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.