Scaffold Ga0051092_1000525

Overview

Basic Information

• Taxon OID: 3300003151
• Scaffold ID: Ga0051092_1000525
• Source Dataset Name: Alvinella pompejana epibiont microbial communities from the East Pacific Rise hydrothermal vent
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: SymBio Corporation
• Sequencing Status: Finished

Scaffold Components

• Scaffold Length (bps): 4484
• Total Scaffold Genes: 10
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Annelida → Integument → Cuticle → Epibionts → Alvinella Pompejana Epibiont → Alvinella Pompejana Epibiont Microbial Communities From The East Pacific Rise Hydrothermal Vent

Source Dataset Sampling Location

• Location Name: East Pacific Rise
• Coordinates
  • Lat. (^o): 9.8344
  • Long. (^o): -104.2844
  • Depth (m): 2500

Associated Families

Family	Category	Number of Sequences	3D Structure?
F088984	Metagenome / Metatranscriptome	109	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0051092_10005259	F088984	N/A	MIAFFRSPSISLWWAHVTDTPDARRTAVFRRGTANGSRGVIPGGGQLQPISGVGDNLLWKNAQKILMKNITSEAMKKIIPQRSPWATTEV*