| Basic Information | |
|---|---|
| Taxon OID | 3300003146 Open in IMG/M |
| Scaffold ID | Ga0051080_1020832 Open in IMG/M |
| Source Dataset Name | Human fecal microbial communities from Washington University at St. Louis, Missouri, USA, of twins - TS28 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Washington University in St. Louis |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3444 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Dorea → Dorea longicatena | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Huma Fecal → Human Fecal Microbial Communities From Washington University At St. Louis, Missouri, Usa, Of Twins |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Washington University at St. Louis, Missouri, USA | |||||||
| Coordinates | Lat. (o) | 38.63549 | Long. (o) | -90.264891 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F056309 | Metagenome | 137 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0051080_10208321 | F056309 | AGGA | MWNAVRNTKRVRSTVKGTKRTCLRRTPSLSVVPLLLGDSDSLSVSYGMEPEQEALSIVSFKD* |
| ⦗Top⦘ |