Scaffold Ga0051127_10440

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0051127_10440

Scaffold Ga0051127_10440

Overview

Basic Information
Taxon OID	3300003069 Open in IMG/M
Scaffold ID	Ga0051127_10440 Open in IMG/M
Source Dataset Name	Coral viral communities from Mount Irvine Bay, Buccoo, Tobago - bleached corals
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	711
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Cnidaria → Unclassified → Unclassified → Unclassified → Coral → Coral Viral Communities From Mount Irvine Bay, Buccoo, Tobago, From Healthy And Bleached Corals

Source Dataset Sampling Location
Location Name	Mount Irvine Bay, Buccoo, Tobago
Coordinates	Lat. (^o)	11.183496	Long. (^o)	-60.816715	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067639	Metagenome	125	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0051127_104401	F067639	GAG	MTVSYSELVTQIRAYTEVDSSVLSDTIVNDFIEFAENRTFRDVGCGR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.