| Basic Information | |
|---|---|
| Family ID | F067639 |
| Family Type | Metagenome |
| Number of Sequences | 125 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MTTYSELVTQIRDYTETTSDVLTDTIVNDFIEHAEKRIF |
| Number of Associated Samples | 102 |
| Number of Associated Scaffolds | 125 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 61.60 % |
| % of genes near scaffold ends (potentially truncated) | 97.60 % |
| % of genes from short scaffolds (< 2000 bps) | 87.20 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.62 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (71.200 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (40.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (83.200 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (87.200 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.31% β-sheet: 0.00% Coil/Unstructured: 62.69% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.62 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 125 Family Scaffolds |
|---|---|---|
| PF10124 | Mu-like_gpT | 0.80 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 71.20 % |
| All Organisms | root | All Organisms | 28.80 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 40.00% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 13.60% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 12.80% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 10.40% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 2.40% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.40% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.60% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 1.60% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 1.60% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 1.60% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.80% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.80% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.80% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.80% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.80% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.80% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.80% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.80% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.80% |
| Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids | 0.80% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.80% |
| Volcanic Co2 Seep Seawater | Environmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seep Seawater | 0.80% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.80% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.80% |
| Coral | Host-Associated → Cnidaria → Unclassified → Unclassified → Unclassified → Coral | 0.80% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
| 3300000949 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94 | Host-Associated | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001853 | Marine viral communities from the Subarctic Pacific Ocean - LP-49 | Environmental | Open in IMG/M |
| 3300001963 | Marine microbial communities from Nags Head, North Carolina, USA - GS013 | Environmental | Open in IMG/M |
| 3300002242 | Marine sediment microbial communities from Kolumbo Volcano mats, Greece - white/grey mat | Environmental | Open in IMG/M |
| 3300003069 | Coral viral communities from Mount Irvine Bay, Buccoo, Tobago - bleached corals | Host-Associated | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006750 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG | Environmental | Open in IMG/M |
| 3300006751 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006923 | Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300006927 | Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300007113 | Seawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble' site, Water-is | Environmental | Open in IMG/M |
| 3300007231 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300009124 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf | Environmental | Open in IMG/M |
| 3300009412 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s2 | Environmental | Open in IMG/M |
| 3300009422 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009550 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome | Environmental | Open in IMG/M |
| 3300009603 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904 | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010155 | Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaG | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300014903 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay12, Core 4567-28, 21-24 cm | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017732 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11 | Environmental | Open in IMG/M |
| 3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
| 3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020274 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX556029-ERR598943) | Environmental | Open in IMG/M |
| 3300020282 | Marine microbial communities from Tara Oceans - TARA_B100000963 (ERX556074-ERR599169) | Environmental | Open in IMG/M |
| 3300020405 | Marine microbial communities from Tara Oceans - TARA_B000000532 (ERX556129-ERR599012) | Environmental | Open in IMG/M |
| 3300020428 | Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020457 | Marine microbial communities from Tara Oceans - TARA_B100001113 (ERX555941-ERR599014) | Environmental | Open in IMG/M |
| 3300020460 | Marine microbial communities from Tara Oceans - TARA_A100001037 (ERX555931-ERR599097) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300021792 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Illium_FS922 150_kmer | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300022167 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2) | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300023235 | Saline water microbial communities from Ace Lake, Antarctica - #50 | Environmental | Open in IMG/M |
| 3300024244 | Seawater microbial communities from Monterey Bay, California, United States - 125D_r | Environmental | Open in IMG/M |
| 3300025052 | Marine viral communities from the Pacific Ocean - LP-37 (SPAdes) | Environmental | Open in IMG/M |
| 3300025071 | Marine viral communities from the Pacific Ocean - LP-36 (SPAdes) | Environmental | Open in IMG/M |
| 3300025085 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025096 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025122 | Marine viral communities from the Pacific Ocean - ETNP_2_300 (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025305 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025806 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028022 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750m | Environmental | Open in IMG/M |
| 3300029309 | Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440 | Environmental | Open in IMG/M |
| 3300029319 | Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516 | Environmental | Open in IMG/M |
| 3300031599 | Marine microbial communities from water near the shore, Antarctic Ocean - #71 | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| 3300032073 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416 | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_102146212 | 3300000101 | Marine | MTTYAELTQQIIDYTETDSNVLTTTILNDIIEHAESRVFRNVDLDIFK |
| BBAY92_100652743 | 3300000947 | Macroalgal Surface | MTTYSELVDQIRSYTETSSDVLTTTVVNDFISQAELRIFREVDLDIF |
| BBAY94_102223872 | 3300000949 | Macroalgal Surface | MTTYTELVDQIRAYTETDSNVLTTTIINDFIEHAENRI |
| JGI24003J15210_100480353 | 3300001460 | Marine | MTTYAELKQQILDYTETDSNVLTDTIINDIIEHAELKIFREID |
| JGI24524J20080_10248391 | 3300001853 | Marine | VTTYSELVTQIRDYCEVDNTVLTDVIVNDFIEHTENRIF |
| GOS2229_10286053 | 3300001963 | Marine | MTTYSELQTQIRDYTETSSDVLTDSILNDFIEHAEKRIFRD |
| KVWGV2_102486962 | 3300002242 | Marine Sediment | MTTYTELVQQIRDYTETDSSVLTDSIINDFIEHTENRILKELDLPVFRS |
| KVWGV2_108058361 | 3300002242 | Marine Sediment | MTTYAELTQQIIDYTETDSNVLTTAILNDIIEHAESR |
| Ga0051127_104401 | 3300003069 | Coral | MTVSYSELVTQIRAYTEVDSSVLSDTIVNDFIEFAENRTFRDVGCGR |
| Ga0098038_11662963 | 3300006735 | Marine | MTTYSELVDQIRSYTETSSDVLTTAIVNTFISQAELRIFREVDLDVFRSYEF |
| Ga0098037_12528432 | 3300006737 | Marine | MTTYTELVQQIRDYTETDSSVLTDSIVNDFIEHTENK |
| Ga0098037_12544611 | 3300006737 | Marine | MTTYAELVDQIRSYTETSSDVLTTTIVNDFINQAELRIFREVDL |
| Ga0098058_10425791 | 3300006750 | Marine | MTTYSELVTQIREYTETDSNVLTTTIINDMIEHAEMRLYR |
| Ga0098040_11596241 | 3300006751 | Marine | MTTYNDLVTQIRDYTETSSDVLTDTIINDFIEHTENKILRDLDLP |
| Ga0098044_10872791 | 3300006754 | Marine | MTTYSDLVTQIRDYTETSSDVLTDTIINDFIEHTENKILRD |
| Ga0098054_13524791 | 3300006789 | Marine | MTTYSELVDQIRSYTETDSNVLTTTIINDFIENPELRIFRE |
| Ga0070749_107425082 | 3300006802 | Aqueous | MTTYSELLTQIRDYTETSSDVLTDTILDDFIQHAEKR |
| Ga0075479_102698153 | 3300006870 | Aqueous | MSTYAEVVDQIRAYTETSSDVLTDTVVNDFISQAE |
| Ga0070750_100340531 | 3300006916 | Aqueous | MTTFSDLQTQIRQYTETSSDVLTDTVVNDFILQAELRIFREVDLDC |
| Ga0070750_102197731 | 3300006916 | Aqueous | MTTYSELVDQIRSYTETSSDVLTTTVVNDFINQAELRIF |
| Ga0070748_10656443 | 3300006920 | Aqueous | MTTYSELVDQIRAYTETDSNVLTTTIVNDFIANSENR |
| Ga0070748_13507241 | 3300006920 | Aqueous | MTTYSELVDQIRNYTETSSDVLTTTIINDLINQAELRIFREVD |
| Ga0098060_11187061 | 3300006921 | Marine | MTTYSELQTQIRDYTETDSTVLTDIIVDDFIEHAEKR |
| Ga0098053_11159242 | 3300006923 | Marine | MTTYAELVTQIREYTETDSNVLSTTIINDMIEHAED |
| Ga0098051_11635542 | 3300006924 | Marine | MTTYTELVQQIRDYTETSSDVLTDTIVNDIIEHTENKIL |
| Ga0098050_10208811 | 3300006925 | Marine | MTTFSELQTQIRNYTETSSDVLTDTVVNDFISQAELRIFREVD |
| Ga0098034_12175912 | 3300006927 | Marine | MTTYTELVTQIRDYTETDSNVLTSVIINDFIEHTENKILR |
| Ga0098041_10264321 | 3300006928 | Marine | MTTYTELKQQIRDYTETDSSVLTDTIINDFIEHTENSILKNLDLP |
| Ga0098041_12502971 | 3300006928 | Marine | MTTYSELVTQIRDYTEVSSDVLTDTRVNDFIEHTENRIFRD |
| Ga0098036_10102341 | 3300006929 | Marine | MTTYAELVTQIREYTETDSNVLTTTIINDMIEHAEMRLYRELD |
| Ga0098036_12059102 | 3300006929 | Marine | MTTYSELVDQIRSYTETSSDVLTTTIVNDFISQAELRI |
| Ga0101666_10965261 | 3300007113 | Volcanic Co2 Seep Seawater | MTTYTELVSQIRDYTETSSDVLSDTIINDFIEHTENKILRDLD |
| Ga0075469_100984941 | 3300007231 | Aqueous | MTTYAELTQQIIDYTETDSNVLTTTILNDIIEHAESRVFRNVD |
| Ga0070747_10196476 | 3300007276 | Aqueous | MTTFSDLQTQIRQYTETSSDVLTDTVVNDFILQAELRIFREVDLDCFR |
| Ga0099847_12152211 | 3300007540 | Aqueous | MTTYAELVTQIKEYTETDSNVLTTTIVNDFIEHAELRIFRE |
| Ga0110931_11553153 | 3300007963 | Marine | MTTYSELVTQIRDYTETDSNVLTTTIINDFIEHAELK |
| Ga0098052_13712761 | 3300008050 | Marine | MTTYAELVDQIRAYTETDSNVLSTTIVNDFIEFAENRIFREVDLDV |
| Ga0118687_104154492 | 3300009124 | Sediment | MTTYAELVDQIRAYTETDSNVLTTTIVNDFISNAENRIF |
| Ga0114903_10122965 | 3300009412 | Deep Ocean | MTTYSELVTQIREYTETDSSVLSDTIVNDFIEHTE |
| Ga0114998_103246953 | 3300009422 | Marine | MTTFAELQEQIRQYTETDNTVLTDTIVNDFILQAELRIFRE |
| Ga0114932_101608994 | 3300009481 | Deep Subsurface | MTTYSELVDQIRNYTETDSNVLTTTIVNDIIENAELR |
| Ga0115013_109513842 | 3300009550 | Marine | MTVTYAELVTQIRAYTEVDSSVLSDTVVNDFIEFSENVVRTFSEQI* |
| Ga0115013_113222052 | 3300009550 | Marine | MTTYSELQTQIRDYTETSSDVLTDAILNDFIEHAEKRIFRDVD |
| Ga0114911_10279581 | 3300009603 | Deep Ocean | MTTYSELVTQIRSYTETDSSVLSDTIVDDFIEHTENDL |
| Ga0114933_100803125 | 3300009703 | Deep Subsurface | MTTYTELVQQIRDYTETSSDVLTDTIVDDIIEHTENK |
| Ga0098049_10740233 | 3300010149 | Marine | MTTYSELVTQIRDYTETDSNVLTDIIVNDFIEHAEKRI |
| Ga0098056_10352451 | 3300010150 | Marine | MTTYSELVDQIRSYTETSSDVLTTAIVNTFISQAELRIFREVDLDVFRS |
| Ga0098056_11407903 | 3300010150 | Marine | MTTYSELVDQIRSYTETSSDVLTTTVVNDFINQAELRIFREVDLDVFRSY |
| Ga0098056_12649951 | 3300010150 | Marine | MTTFSELQTQIRNYTETSSDVLTDTVVNDFISQAELRIFR |
| Ga0098059_13027491 | 3300010153 | Marine | MTTYTELVTQIRDYTETSSDVLSDTIINDFIEHTENKILRDLDLP |
| Ga0098059_13210941 | 3300010153 | Marine | MTVTYAELVTQIRAYTEVDSSVLSDTIVNDFIEFSENR |
| Ga0098059_13799633 | 3300010153 | Marine | MTVTHSELVTQIRAYTEVDSSVLSDTIVNDFIEFA |
| Ga0098047_102322453 | 3300010155 | Marine | MSTYAEVVEQIRSYTETSSDVLTTTIVNDFINQAELRIFREV |
| Ga0098047_103096652 | 3300010155 | Marine | MTTYTELVTQIRDYTETDSNVLTSVIINDFIEHTE |
| Ga0129324_100123349 | 3300010368 | Freshwater To Marine Saline Gradient | MTTYAELVTQIRDYAETDDQVLTTTIINDIIEHAENRIFRDIEL |
| Ga0129324_101519173 | 3300010368 | Freshwater To Marine Saline Gradient | MTTYSELLTQIRDYTETSSDVLTDTILDDFIQHAEKRIFR |
| Ga0129324_102022573 | 3300010368 | Freshwater To Marine Saline Gradient | MTVSYSELVTQIRAYTEVDSSVLSDTIVNDFIEFAENRIF |
| Ga0160423_104808803 | 3300012920 | Surface Seawater | MTTYAELVDQIRDYTETDSNVFTSTIVNDFISNAEN |
| Ga0164321_107233242 | 3300014903 | Marine Sediment | MTTYSELVDQIKSYTETSSDVLTTTIVNTFINQAELRIFR |
| Ga0181403_11314132 | 3300017710 | Seawater | MTTHSELQTQIRDYTETDSAVLTDIIVNDFIEHAEK |
| Ga0181412_10483942 | 3300017714 | Seawater | MTTYAELVTQIRDYSETDSAVLTTTILNDIIANAEDKIFR |
| Ga0181419_11011543 | 3300017728 | Seawater | MTTYSELQTQIRDYTETSSDVLTDAILNDFIEHAE |
| Ga0181415_10221541 | 3300017732 | Seawater | MTTYAELTQQIIDDTETESNVLTTTILNDIIEHAESRIFRN |
| Ga0181418_10127225 | 3300017740 | Seawater | MTTFADLQTQIRQYTETSSDVLTDTVVNDFILQAELRIFREV |
| Ga0181427_11272432 | 3300017745 | Seawater | MSTYAEVVDQIRSYTETDSNVLTTTVVNDFINQAELRIFR |
| Ga0187219_11529023 | 3300017751 | Seawater | MTTYSELQTQIRDYTETSSDVLTDAILNDFIEHAEKRIFREVDL |
| Ga0181409_10070371 | 3300017758 | Seawater | MTTYSELVDQIRSYAETSSDVLTTTVVNDFISQAELRIFREVDLDI |
| Ga0181410_10110931 | 3300017763 | Seawater | MTTYAELTQQIIDYTETDSNVLTTTILNDIIEHAESRIFRNVDLDIFKK |
| Ga0181410_11303113 | 3300017763 | Seawater | MTTYSELVTQIRDYTETDSNVLTTVIINDFIEHAESK |
| Ga0181385_10779013 | 3300017764 | Seawater | MTTYSELVTQIRDYTETDSNVFTTVIVNDFIEHAE |
| Ga0187221_11197703 | 3300017769 | Seawater | MSTYAELVDQIRSYTETSSDVLTTTVVNDFINQAELRI |
| Ga0181430_11857581 | 3300017772 | Seawater | MTTYAELTQQIIDYTETDSNVLTTTILNDIIEHAESRI |
| Ga0181386_11458023 | 3300017773 | Seawater | MTVTYAELVTQIRAYTEVDSSVLSDTVVNDFIEFSENR |
| Ga0181386_11654251 | 3300017773 | Seawater | MTTYSELVTQIRDYTETDSNVFTTVIVNDFIEHAELR |
| Ga0181386_12102351 | 3300017773 | Seawater | MTTYAELVTQIRDYSETDSAVLTTTIINDIIENAEDR |
| Ga0181394_10172387 | 3300017776 | Seawater | MTTYSELVDQIRSYTETSSDVLTTTVVNDFISQAELRIFREVDLDIFRA |
| Ga0181553_107370221 | 3300018416 | Salt Marsh | MTTYTELVQQIRDYTETDSSVLTDSIINDFIEHTENRILKELDLPVFRSYQF |
| Ga0211658_11151341 | 3300020274 | Marine | MTTYAELVTQIRDYAETDDQVLTTTIINDIIEHAE |
| Ga0211667_10315113 | 3300020282 | Marine | MTTYAELVTQIRSYTETDDQVLTDTVVNDFIEHAEHRIFRAIELNSDYSYV |
| Ga0211667_10490311 | 3300020282 | Marine | MTTYAELVTQIRGYTETDDQVLTDTIVNDFIEHAEHRIFRAIELNSDYSYV |
| Ga0211496_100255361 | 3300020405 | Marine | MTTYTELLAQIRDYTETDSAVLTDAICNDFIEHAEIRIF |
| Ga0211521_102733391 | 3300020428 | Marine | MTTYAELTQQIIDYTETDSNVLTTAILNDIIEHAESRIFRNADLDVFKK |
| Ga0211576_102158292 | 3300020438 | Marine | MTTYTELKQQILDYCETDSAVLTDVIMNDIIEHAEHRI |
| Ga0211643_101550872 | 3300020457 | Marine | MTTYAELVTQIRSYTETDDQVLTDTVVNDFIEHAEHRIFRAIELNSDYSY |
| Ga0211486_101183651 | 3300020460 | Marine | MTTYAELVTQIRDYTETDNQVLTDTIINDFIEHSEHRIFR |
| Ga0211577_106635481 | 3300020469 | Marine | MTTFAELQTQIRQYTETSSDVLTDTVVNDFILQAELRIFREID |
| Ga0211577_106698162 | 3300020469 | Marine | MTTYAELTQQIIDYTETDSNVLTTTILNDIIEHAESRVFRNV |
| Ga0226836_104960053 | 3300021792 | Hydrothermal Vent Fluids | MTVSYSELVTQIRAYTEVDSSVLSDTIVNDFIEFAENRIFR |
| Ga0222718_104789552 | 3300021958 | Estuarine Water | MTTYSELVDQIRAYTETDSNVLTTTIVNDFISNAENRIFREV |
| Ga0212020_10588641 | 3300022167 | Aqueous | MTTYSELLTQIRDYTETSSDVLTDTILDDFIEHAEKRI |
| Ga0196901_11130881 | 3300022200 | Aqueous | MSTYTEVVDQIRSYTETDSTVLTTAIVNDFINQAELR |
| Ga0222634_10380993 | 3300023235 | Saline Water | MTTYAELVEQIRSYTETDSTVLTQTIVNDVILQAEIRV |
| Ga0228678_10392101 | 3300024244 | Seawater | MTTYTELKQQILDYCETDAAVLTTTILDDIIEHAEHRIFRSIELD |
| Ga0207906_10045981 | 3300025052 | Marine | MTTYTELVDQVRSYTETDSNVLTSAIINDFIEHTENKILRDL |
| Ga0207896_10014361 | 3300025071 | Marine | MTTYSELVDQIRSYTETSSDVLTTTVINDFINQAELRIFREV |
| Ga0207896_10229283 | 3300025071 | Marine | MTTFAQLQTQIREYTETDSNVLTDTIVNTFISQAELRVF |
| Ga0208792_10270821 | 3300025085 | Marine | MSTYAEVVEQIRSYTETSSDVLTTTIVNDFINQAEL |
| Ga0208157_10907301 | 3300025086 | Marine | MTTYAELVDQIRSYTETSSDVLTTTIVNDLISQAELRIFR |
| Ga0208011_10163251 | 3300025096 | Marine | MTTYNDLVTQIRDYTETSSDVLTDTIINDFIEHNENKIL |
| Ga0208434_10843372 | 3300025098 | Marine | MSTYAEVVEQIRSYTETSSDVLTTTIVNDFINQAELRIFREVDL |
| Ga0208666_10153731 | 3300025102 | Marine | MTTYSELVDQIRSYTETSSDVLTTAIVNTFISQAEL |
| Ga0208013_10884313 | 3300025103 | Marine | MTTYSELVTQIRDYTETDSNVLTTTILNDFIEHTENRIL |
| Ga0208793_10385771 | 3300025108 | Marine | MTTYTELVTQIRDYTETDANVLTSTIVNDFIEHTE |
| Ga0209434_11843882 | 3300025122 | Marine | MTTYSELVTQIRAYTETDSSVLSDTIVNDFIEHTENDLVRQLDIPA |
| Ga0209348_10410011 | 3300025127 | Marine | MTVSYSELVTQIRAYTEVDSSVLSDTIVNDFIEFA |
| Ga0208919_10907101 | 3300025128 | Marine | MTTYTELVTQIRDYTETSSDVLSDTIVNDFIEHTENKI |
| Ga0208919_11509771 | 3300025128 | Marine | MTTYSELQTQIRDYTETSSDVLTDAILNDFIEHAEK |
| Ga0209232_12092601 | 3300025132 | Marine | MTTYSELQTQIRDYTETSSDVLTDSIINDFIEHAEKRIF |
| Ga0209645_12041172 | 3300025151 | Marine | MTTYAELVTQIRDYAETDDQVLTTTIINDIIAHAEDRIFRNVELDN |
| Ga0209337_11057171 | 3300025168 | Marine | MTTYTELVTQIREYTETDSNVLTDTIVDDFIEHTENRI |
| Ga0208684_10364414 | 3300025305 | Deep Ocean | MTTYSELVTQIRSYTETDSSVLSDTIVDDFIEHTENDLVRQLD |
| Ga0208134_11616152 | 3300025652 | Aqueous | MTTYSELVTQIRDYTETDSNVLTTTIINDFIEHAE |
| Ga0208899_11148411 | 3300025759 | Aqueous | MSTYAEVVEQIRAYTETDSNVLTTTVVNDFINQAELRIFREVDLDCF |
| Ga0208899_12198501 | 3300025759 | Aqueous | MTTYSELLTQIRDYTETSSDVLTDTILDDFIQHAEKRI |
| Ga0208545_10174657 | 3300025806 | Aqueous | MTTYSELLTQIRDYTETSSDVLTDTILDDFIQHAEK |
| Ga0209404_100795914 | 3300027906 | Marine | MTTYSELVTQIREYTETDSNVLTTTIINDMIEHAEMRLYRE |
| Ga0256382_10117061 | 3300028022 | Seawater | MTSYSELVTQIRDYTETDSNSLTSTIIDDFIEHTEN |
| Ga0183683_10217443 | 3300029309 | Marine | MTTYSELVTQIRDYTETTSDVLTDTIVNDFIEHAEKRIF |
| Ga0183748_10316334 | 3300029319 | Marine | MTTYAELTQQVLDYTETDSNVLTTAIINDFIEHAEIKI |
| Ga0183748_10885313 | 3300029319 | Marine | MTVSYSELVTQIRAYTEVDSSVLSDTIVNDFIEFAENRIFRD |
| Ga0308007_102478591 | 3300031599 | Marine | MSTYAELKQQVLDYCETDSAVLTDTILNDIIEHAEHRIFRSIELDNQ |
| Ga0315316_100501076 | 3300032011 | Seawater | MTTYAELVTQIRDYAETDDAVLTTVIINDIIEHSEKRIF |
| Ga0315315_114541981 | 3300032073 | Seawater | MTTYSELQTQIRDYTETSSDVLTDAILNDFIEHAEKRIFRD |
| Ga0314858_045851_924_1049 | 3300033742 | Sea-Ice Brine | MTTYAELKQQILDYTETDDNVLTDTIVNDIIEHAESKLFKEI |
| Ga0348336_107434_810_926 | 3300034375 | Aqueous | MSTYAEVVEQIRAYTETDSNVLTTTVVNDFINQAELRIF |
| ⦗Top⦘ |