| Basic Information | |
|---|---|
| Taxon OID | 3300002734 Open in IMG/M |
| Scaffold ID | PetF_10064891 Open in IMG/M |
| Source Dataset Name | Microbial sample from Petrosia ficiformis |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1435 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Petrosia Ficiformis → Petrosia Ficiformis Microbial Communities From Milos, Greece |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Milos,Greece | |||||||
| Coordinates | Lat. (o) | 36.76759 | Long. (o) | 24.51422 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F072776 | Metagenome | 121 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| PetF_100648912 | F072776 | GGAGG | MYIDCDTHYFPVKFLEGISDQYPDSPRVVRKGDEVKSVLPDGTLIKNQAPKGRWDLDVRVAQADFEGFDKHVLIPENRELLY |
| ⦗Top⦘ |