Scaffold Ga0005227J37284_1009897

Overview

Basic Information

• Taxon OID: 3300002688
• Scaffold ID: Ga0005227J37284_1009897
• Source Dataset Name: Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - MetaT SI072_100m_A (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 722
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location

• Location Name: British Columbia, Canada
• Coordinates
  • Lat. (^o): 48.7299
  • Long. (^o): -123.5699

Associated Families

Family	Category	Number of Sequences	3D Structure?
F099485	Metagenome / Metatranscriptome	103	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0005227J37284_10098971	F099485	N/A	NWQHSPSKTQVARTPVKAVSKSLQQSQTFTHEDLMGLSWMLSEEGD*