Scaffold TOLCLC_10257908

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold TOLCLC_10257908

Scaffold TOLCLC_10257908

Overview

Basic Information
Taxon OID	3300002498 Open in IMG/M
Scaffold ID	TOLCLC_10257908 Open in IMG/M
Source Dataset Name	Hydrocarbon resource environments microbial communities from Canada and USA - Toluene degrading community from Alberta, Canada
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	McGill University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	670
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Source Dataset Sampling Location
Location Name	Northern Alberta, Canada
Coordinates	Lat. (^o)	54.0	Long. (^o)	-114.0	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080313	Metagenome	115	Y

Sequences

Protein ID	Family	RBS	Sequence
TOLCLC_102579082	F080313	GAGG	MLDRPTIMVVDDEPTALASMLDALTRRFGGDYRIEPHLSPP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.