Scaffold LBB32012_10037381

Overview

Basic Information

• Taxon OID: 3300002039
• Scaffold ID: LBB32012_10037381
• Source Dataset Name: Delisea pulchra microbial communities from Sydney, Australia, affected by bleaching disease - 2012_LB_B3
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1526
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Algae → Red Algae → Ectosymbionts → Unclassified → Delisea Pulchra → Delisea Pulchra Microbial Communities From Sydney, Australia, Affected By Bleaching Disease

Source Dataset Sampling Location

• Location Name: Long Bay, Sydney, Australia
• Coordinates
  • Lat. (^o): -33.57
  • Long. (^o): 151.15
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078742	Metagenome / Metatranscriptome	116	Y

Sequences

Protein ID	Family	RBS	Sequence
LBB32012_100373814	F078742	GGAG	VEQLSVGTGSDLIDYGRLEVKEDGSWDVLASSSLAEEGVEGIVSSSDGLIRWHLTVWLDTVLKAEQFPTGVTNLNTSLSDMD*