Scaffold BBAY61_100123

Overview

Basic Information

• Taxon OID: 3300002018
• Scaffold ID: BBAY61_100123
• Source Dataset Name: Delisea pulchra microbial communities from Sydney, Australia, affected by bleaching disease - BBAY61
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1078
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Algae → Red Algae → Ectosymbionts → Unclassified → Delisea Pulchra → Delisea Pulchra Microbial Communities From Sydney, Australia, Affected By Bleaching Disease

Source Dataset Sampling Location

• Location Name: Bare Island, Sydney, Australia
• Coordinates
  • Lat. (^o): -33.59
  • Long. (^o): 151.13
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F037234	Metagenome / Metatranscriptome	168	Y

Sequences

Protein ID	Family	RBS	Sequence
BBAY61_1001231	F037234	N/A	KTSLDKPYEKMNKYLELDPKASDLTMVRVIKARTGYRCIDIRRIVVS*