Scaffold SAHD_10055135

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold SAHD_10055135

Scaffold SAHD_10055135

Overview

Basic Information
Taxon OID	3300001682 Open in IMG/M
Scaffold ID	SAHD_10055135 Open in IMG/M
Source Dataset Name	Cattle waste upflow reactor
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1765
Total Scaffold Genes	6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Anaerobic) → Activated Sludge → Activated Sludge → Activated Sludge Microbial Communities From The University Of Illinois, Usa, From Bioreactors Seeded With Cattle Waste

Source Dataset Sampling Location
Location Name	USA: University of Illionis
Coordinates	Lat. (^o)	40.103885	Long. (^o)	-88.225087	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F069434	Metagenome / Metatranscriptome	124	Y

Sequences

Protein ID	Family	RBS	Sequence
SAHD_100551355	F069434	AGGAGG	MNRIFDKTTCWNIFDHTDSPDPLWDLQRQGKHREAQKAAIRLTLRHPLRMLPVIVNCLRCGRS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.