NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI11834J15748_1014232

Scaffold JGI11834J15748_1014232


Overview

Basic Information
Taxon OID3300001579 Open in IMG/M
Scaffold IDJGI11834J15748_1014232 Open in IMG/M
Source Dataset NameMarine microbial communities from the Deep Atlantic Ocean - MP0740
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)521
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location NameSouth Atlantic Ocean
CoordinatesLat. (o)-31.81Long. (o)6.84Alt. (m)Depth (m)4001.3
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F085813Metagenome111N

Sequences

Protein IDFamilyRBSSequence
JGI11834J15748_10142322F085813N/AMDQIEIIWILVTGIGALNYGLNAYQKGFRRLLKWDVIFLIILNTLMFVPLSLIVGLS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.