Scaffold JGI11834J15748_1005437

Overview

Basic Information

• Taxon OID: 3300001579
• Scaffold ID: JGI11834J15748_1005437
• Source Dataset Name: Marine microbial communities from the Deep Atlantic Ocean - MP0740
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 981
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. IMCC9063 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: South Atlantic Ocean
• Coordinates
  • Lat. (^o): -31.81
  • Long. (^o): 6.84
  • Depth (m): 4001.3

Associated Families

Family	Category	Number of Sequences	3D Structure?
F063069	Metagenome	130	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI11834J15748_10054371	F063069	AGTAG	MPNSPWEIFNSSLILELNSPIKKLCPTHEKKVKTKPKIIILKLDLTISIIMFNYEL*