Scaffold chfec4_10012629

Overview

Basic Information

• Taxon OID: 3300001525
• Scaffold ID: chfec4_10012629
• Source Dataset Name: Chimp virome sample 4
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2862
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Primate Fecal → Primate Fecal Viral Communities From Gombe National Park, Tanzania

Source Dataset Sampling Location

• Location Name: Gombe National Park, Tanzania
• Coordinates
  • Lat. (^o): -4.4
  • Long. (^o): 29.38

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076190	Metagenome	118	Y

Sequences

Protein ID	Family	RBS	Sequence
chfec4_100126297	F076190	N/A	VRTAGGSITTPAGNAPTAASRVSGRAWWLARITAPNGLKSVKIRVGKPQNNPLYPHFQREPL*