| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300001525 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0095260 | Gp0057791 | Ga0012980 |
| Sample Name | Chimp virome sample 4 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 304720290 |
| Sequencing Scaffolds | 5 |
| Novel Protein Genes | 5 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 2 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 1 |
| Not Available | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Primate Fecal Viral Communities From Gombe National Park, Tanzania |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Primate Fecal → Primate Fecal Viral Communities From Gombe National Park, Tanzania |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Gombe National Park, Tanzania | |||||||
| Coordinates | Lat. (o) | -4.4 | Long. (o) | 29.38 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F029589 | Metagenome / Metatranscriptome | 188 | Y |
| F056682 | Metagenome | 137 | Y |
| F076190 | Metagenome | 118 | Y |
| F092227 | Metagenome | 107 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| chfec4_10000407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 29586 | Open in IMG/M |
| chfec4_10012629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 2862 | Open in IMG/M |
| chfec4_10067737 | Not Available | 852 | Open in IMG/M |
| chfec4_10124865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 558 | Open in IMG/M |
| chfec4_10136984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 523 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| chfec4_10000407 | chfec4_1000040726 | F092227 | MNEQKRKRILRVGCLLLAGVFLLSVLGSVILMLLV* |
| chfec4_10012629 | chfec4_100126297 | F076190 | VRTAGGSITTPAGNAPTAASRVSGRAWWLARITAPNGLKSVKIRVGKPQNNPLYPHFQREPL* |
| chfec4_10067737 | chfec4_100677372 | F029589 | MKEYEIVIKCTNACAGSSRPQTFFEEAELENPAGYIREKHGRDFEKFQEEVLPDGRIVYSWDNGSVAYHYEFTEL* |
| chfec4_10124865 | chfec4_101248652 | F092227 | MNEQKHKRWLRIGCLILAGVFALSLLSSVIMMLLF* |
| chfec4_10136984 | chfec4_101369842 | F056682 | MKTLSRAGKVANQPIGQGKMYSASFRVFLLKNHITFPFQELGKIYKNQEVL* |
| ⦗Top⦘ |