Scaffold rank12_10117891

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold rank12_10117891

Scaffold rank12_10117891

Overview

Basic Information
Taxon OID	3300001484 Open in IMG/M
Scaffold ID	rank12_10117891 Open in IMG/M
Source Dataset Name	Sheep rumen microbial communities from New Zealand - Rank12_low
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1412
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (80.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Sheep Rumen → Sheep Rumen Microbial Communities From New Zealand From High And Low Methane Emitting Sheep

Source Dataset Sampling Location
Location Name	Palmerston North, New Zealand
Coordinates	Lat. (^o)	-40.352	Long. (^o)	175.608	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F061341	Metagenome / Metatranscriptome	132	Y

Sequences

Protein ID	Family	RBS	Sequence
rank12_101178915	F061341	GGAGG	MAKKKNITVGTIKGIDIIRQTKPMQDIPFRTGVYTDKRKKREKINKNRLDKWL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.