| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300001484 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053113 | Gp0054959 | Ga0012461 |
| Sample Name | Sheep rumen microbial communities from New Zealand - Rank12_low |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 456493960 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → Viruses → Predicted Viral | 1 |
| Not Available | 1 |
| All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group → Methanobacteria → Methanobacteriales → Methanobacteriaceae → Methanobrevibacter → unclassified Methanobrevibacter → Methanobrevibacter sp. | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Sheep Rumen Microbial Communities From New Zealand From High And Low Methane Emitting Sheep |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Mammals → Digestive System → Foregut → Rumen → Sheep Rumen → Sheep Rumen Microbial Communities From New Zealand From High And Low Methane Emitting Sheep |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal proximal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Palmerston North, New Zealand | |||||||
| Coordinates | Lat. (o) | -40.352 | Long. (o) | 175.608 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F032082 | Metagenome / Metatranscriptome | 181 | N |
| F061341 | Metagenome / Metatranscriptome | 132 | Y |
| F072829 | Metagenome / Metatranscriptome | 121 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| rank12_10117891 | All Organisms → Viruses → Predicted Viral | 1412 | Open in IMG/M |
| rank12_10449126 | Not Available | 502 | Open in IMG/M |
| rank12_10497501 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group → Methanobacteria → Methanobacteriales → Methanobacteriaceae → Methanobrevibacter → unclassified Methanobrevibacter → Methanobrevibacter sp. | 550 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| rank12_10117891 | rank12_101178915 | F061341 | MAKKKNITVGTIKGIDIIRQTKPMQDIPFRTGVYTDKRKKREKINKNRLDKWL* |
| rank12_10449126 | rank12_104491261 | F032082 | MNNTSELSTTIKTSTKPGKLTKEETMLRSYNETFYSSLKNLSFIKDPLPIEEKLMYHFEQNDSASVSSTIGQLESTLQELLIKNKEIKEKIIELNGEIQTLKADINKINSNFAPYGPQIKILSKAIKEFVEKQKLENYRLKEEINLLEKEKNEIQQGIYDSLGYLNK |
| rank12_10497501 | rank12_104975012 | F072829 | MENFYNQLIDEYFKRHPDAGLAWWMLPLNEQPEGFKQEMYDIMWDLTHKEEANG* |
| ⦗Top⦘ |