Basic Information | |
---|---|
IMG/M Taxon OID | 3300001484 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053113 | Gp0054959 | Ga0012461 |
Sample Name | Sheep rumen microbial communities from New Zealand - Rank12_low |
Sequencing Status | Permanent Draft |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 456493960 |
Sequencing Scaffolds | 3 |
Novel Protein Genes | 3 |
Associated Families | 3 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → Viruses → Predicted Viral | 1 |
Not Available | 1 |
All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group → Methanobacteria → Methanobacteriales → Methanobacteriaceae → Methanobrevibacter → unclassified Methanobrevibacter → Methanobrevibacter sp. | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Sheep Rumen Microbial Communities From New Zealand From High And Low Methane Emitting Sheep |
Type | Host-Associated |
Taxonomy | Host-Associated → Mammals → Digestive System → Foregut → Rumen → Sheep Rumen → Sheep Rumen Microbial Communities From New Zealand From High And Low Methane Emitting Sheep |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal proximal gut |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Palmerston North, New Zealand | |||||||
Coordinates | Lat. (o) | -40.352 | Long. (o) | 175.608 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F032082 | Metagenome / Metatranscriptome | 181 | N |
F061341 | Metagenome / Metatranscriptome | 132 | Y |
F072829 | Metagenome / Metatranscriptome | 121 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
rank12_10117891 | All Organisms → Viruses → Predicted Viral | 1412 | Open in IMG/M |
rank12_10449126 | Not Available | 502 | Open in IMG/M |
rank12_10497501 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group → Methanobacteria → Methanobacteriales → Methanobacteriaceae → Methanobrevibacter → unclassified Methanobrevibacter → Methanobrevibacter sp. | 550 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
rank12_10117891 | rank12_101178915 | F061341 | MAKKKNITVGTIKGIDIIRQTKPMQDIPFRTGVYTDKRKKREKINKNRLDKWL* |
rank12_10449126 | rank12_104491261 | F032082 | MNNTSELSTTIKTSTKPGKLTKEETMLRSYNETFYSSLKNLSFIKDPLPIEEKLMYHFEQNDSASVSSTIGQLESTLQELLIKNKEIKEKIIELNGEIQTLKADINKINSNFAPYGPQIKILSKAIKEFVEKQKLENYRLKEEINLLEKEKNEIQQGIYDSLGYLNK |
rank12_10497501 | rank12_104975012 | F072829 | MENFYNQLIDEYFKRHPDAGLAWWMLPLNEQPEGFKQEMYDIMWDLTHKEEANG* |
⦗Top⦘ |