Scaffold JGI20197J15136_1018413

Overview

Basic Information

• Taxon OID: 3300001453
• Scaffold ID: JGI20197J15136_1018413
• Source Dataset Name: Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-092012
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 613
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil → Arctic Peat Soil Microbial Communities From The Barrow Environmental Observatory Site, Barrow, Alaska, Usa

Source Dataset Sampling Location

• Location Name: Barrow Environmental Observatory site, Barrow, Alaska
• Coordinates
  • Lat. (^o): 71.2999
  • Long. (^o): -156.61

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002525	Metagenome / Metatranscriptome	552	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI20197J15136_10184132	F002525	N/A	WAGVDSAWEQDSVESWKMLENRADSLLSDARFVGRHLWFIT*