NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold BBAY83_10291033

Scaffold BBAY83_10291033


Overview

Basic Information
Taxon OID3300001263 Open in IMG/M
Scaffold IDBBAY83_10291033 Open in IMG/M
Source Dataset NameMacroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY83
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterJ. Craig Venter Institute (JCVI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)504
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida → Tetrahymenina → Tetrahymenidae → Tetrahymena → Tetrahymena thermophila(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface → Macroalgal Surface Microbial Communities

Source Dataset Sampling Location
Location NameBotany Bay, Sydney, NSW, Australia
CoordinatesLat. (o)-33.966629Long. (o)151.166614Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F023215Metagenome / Metatranscriptome211Y

Sequences

Protein IDFamilyRBSSequence
BBAY83_102910332F023215AGGAMKFSKDLLELRAKEAKLVKMKRYEEAEKVKMKADLLEEFERNKLDAEMHAI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.