| Basic Information | |
|---|---|
| Taxon OID | 3300000353 Open in IMG/M |
| Scaffold ID | ElkS_mat_MD6ADRAFT_1012526 Open in IMG/M |
| Source Dataset Name | Hot spring microbial communities from Elkhorn Slough, Monterey Bay, USA - MD6A |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2098 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline Mat → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Elkhorn Slough, Monterey Bay, California, USA | |||||||
| Coordinates | Lat. (o) | 36.82188 | Long. (o) | -121.744 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F036294 | Metagenome / Metatranscriptome | 170 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| ElkS_mat_MD6ADRAFT_10125263 | F036294 | N/A | MDRGSSDEAIVGVKPTADDDAVTYRRGKLLESDKEVGAEGRNM* |
| ⦗Top⦘ |