NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Cc83DRAFT_1000986

Scaffold Cc83DRAFT_1000986


Overview

Basic Information
Taxon OID3300000302 Open in IMG/M
Scaffold IDCc83DRAFT_1000986 Open in IMG/M
Source Dataset NameCECUM_8-3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity College Cork
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4623
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Birds → Digestive System → Ceca → Unclassified → Chicken Cecum → Chicken Cecum Microbial Communities From Ireland

Source Dataset Sampling Location
Location NameIreland: Cork
CoordinatesLat. (o)51.897783Long. (o)-8.470613Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F072949Metagenome / Metatranscriptome120Y

Sequences

Protein IDFamilyRBSSequence
Cc83DRAFT_10009865F072949GGAGMAKKRNNKVAKVVVDKNAAQFMRTAQNLARKGKTNKKLNGRNANPRAKKYAIA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.