| Basic Information | |
|---|---|
| Taxon OID | 3300000302 Open in IMG/M |
| Scaffold ID | Cc83DRAFT_1000986 Open in IMG/M |
| Source Dataset Name | CECUM_8-3 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University College Cork |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4623 |
| Total Scaffold Genes | 12 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Birds → Digestive System → Ceca → Unclassified → Chicken Cecum → Chicken Cecum Microbial Communities From Ireland |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Ireland: Cork | |||||||
| Coordinates | Lat. (o) | 51.897783 | Long. (o) | -8.470613 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F072949 | Metagenome / Metatranscriptome | 120 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Cc83DRAFT_10009865 | F072949 | GGAG | MAKKRNNKVAKVVVDKNAAQFMRTAQNLARKGKTNKKLNGRNANPRAKKYAIA* |
| ⦗Top⦘ |