Basic Information | |
---|---|
Taxon OID | 3300000302 Open in IMG/M |
Scaffold ID | Cc83DRAFT_1000986 Open in IMG/M |
Source Dataset Name | CECUM_8-3 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University College Cork |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 4623 |
Total Scaffold Genes | 12 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Birds → Digestive System → Ceca → Unclassified → Chicken Cecum → Chicken Cecum Microbial Communities From Ireland |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Ireland: Cork | |||||||
Coordinates | Lat. (o) | 51.897783 | Long. (o) | -8.470613 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F072949 | Metagenome / Metatranscriptome | 120 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Cc83DRAFT_10009865 | F072949 | GGAG | MAKKRNNKVAKVVVDKNAAQFMRTAQNLARKGKTNKKLNGRNANPRAKKYAIA* |
⦗Top⦘ |