| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300000302 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0070986 | Gp0052896 | Ga0011206 |
| Sample Name | CECUM_8-3 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University College Cork |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 62373868 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Chicken Cecum Microbial Communities From Ireland |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Birds → Digestive System → Ceca → Unclassified → Chicken Cecum → Chicken Cecum Microbial Communities From Ireland |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal proximal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Ireland: Cork | |||||||
| Coordinates | Lat. (o) | 51.897783 | Long. (o) | -8.470613 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F072949 | Metagenome / Metatranscriptome | 120 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Cc83DRAFT_1000986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 4623 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Cc83DRAFT_1000986 | Cc83DRAFT_10009865 | F072949 | MAKKRNNKVAKVVVDKNAAQFMRTAQNLARKGKTNKKLNGRNANPRAKKYAIA* |
| ⦗Top⦘ |