3300000302: CECUM_8-3

Overview

Basic Information

• IMG/M Taxon OID: 3300000302
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0070986 | Gp0052896 | Ga0011206
• Sample Name: CECUM_8-3
• Sequencing Status: Permanent Draft
• Sequencing Center: University College Cork
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 62373868
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Chicken Cecum Microbial Communities From Ireland
• Type: Host-Associated
• Taxonomy: Host-Associated → Birds → Digestive System → Ceca → Unclassified → Chicken Cecum → Chicken Cecum Microbial Communities From Ireland

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal proximal gut

Location Information

• Location: Ireland: Cork
• Coordinates
  • Lat. (^o): 51.897783
  • Long. (^o): -8.470613
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F072949	Metagenome / Metatranscriptome	120	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Cc83DRAFT_1000986	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	4623

Sequences

Scaffold ID	Protein ID	Family	Sequence
Cc83DRAFT_1000986	Cc83DRAFT_10009865	F072949	MAKKRNNKVAKVVVDKNAAQFMRTAQNLARKGKTNKKLNGRNANPRAKKYAIA*