| Basic Information | |
|---|---|
| Taxon OID | 3300000271 Open in IMG/M |
| Scaffold ID | PBR_1016862 Open in IMG/M |
| Source Dataset Name | Photobioreactor incubated microbial communities from Hamburg, Germany - Sample 1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Goettingen Genomics Laboratory |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4584 |
| Total Scaffold Genes | 9 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 8 (88.89%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Biotransformation → Microbial Enhanced Oil Recovery → Unclassified → Unclassified → Photobioreactor Incubated → Photobioreactor Incubated Microbial Communities From Hamburg, Germany |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Hamburg, Germany | |||||||
| Coordinates | Lat. (o) | 53.560526 | Long. (o) | 10.15 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F069784 | Metagenome | 123 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| PBR_10168623 | F069784 | GGA | MTQSLKVTKTANRQPLTVRLDPESKKLFSEEAEKCGLEPGVAARQILELYVQRLRESGDYIQTLADFSQAMKTKTA* |
| ⦗Top⦘ |