NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300000271

3300000271: Photobioreactor incubated microbial communities from Hamburg, Germany - Sample 1



Overview

Basic Information
IMG/M Taxon OID3300000271 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0054992 | Gp0054084 | Ga0011191
Sample NamePhotobioreactor incubated microbial communities from Hamburg, Germany - Sample 1
Sequencing StatusPermanent Draft
Sequencing CenterGoettingen Genomics Laboratory
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size164692310
Sequencing Scaffolds5
Novel Protein Genes5
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3
All Organisms → cellular organisms → Bacteria → Proteobacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NamePhotobioreactor Incubated Microbial Communities From Hamburg, Germany
TypeEngineered
TaxonomyEngineered → Biotransformation → Microbial Enhanced Oil Recovery → Unclassified → Unclassified → Photobioreactor Incubated → Photobioreactor Incubated Microbial Communities From Hamburg, Germany

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)na → na → na

Location Information
LocationHamburg, Germany
CoordinatesLat. (o)53.560526Long. (o)10.15Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001506Metagenome / Metatranscriptome681Y
F069784Metagenome123N
F080069Metagenome / Metatranscriptome115Y
F082505Metagenome / Metatranscriptome113Y
F091422Metagenome / Metatranscriptome107Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
PBR_1000032All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria39981Open in IMG/M
PBR_1002334All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3434Open in IMG/M
PBR_1004207All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4503Open in IMG/M
PBR_1016862All Organisms → cellular organisms → Bacteria → Proteobacteria4584Open in IMG/M
PBR_1026391All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3589Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
PBR_1000032PBR_100003228F001506MNRILYEIRCKCNEEISITKKRKSTNRSEGKPLLYPNPTELTSKTFQIKYEKPLSSVAKFLLNSFQNKYLYYAIDDLLYLLNSNLSERDNLLALLYSPVLSLQNNLSINFFDIWIQEIYIHQSVKTNKFLKTNSPTFESSNYIIIKLLYRTKIPVKKQESLW*
PBR_1002334PBR_10023343F082505MWPFTPRCRQAVVVFHIDQDGIARGAFFRGDADVLIIDERDPKNRIYRMTAESSVEELRRKIGRHPLGSLLEVPRDKERNQTPVLNLHWRSDGVHAG*
PBR_1004207PBR_10042074F080069MKKPRGLKRKLAAIFGCTVALTAAMPAFADDVAGQWLFDTSKFAGNDCQIVGKITFMTTPVKNTYTCVFESEQICGKLNGDLYIRVRQVCTAQRVGKQVAIQSEVDKVLERRPYMPPDLAKMQYLADNFILQLSANKAEMNGEHYDEQRSLNARFWRDVELIS*
PBR_1016862PBR_10168623F069784MTQSLKVTKTANRQPLTVRLDPESKKLFSEEAEKCGLEPGVAARQILELYVQRLRESGDYIQTLADFSQAMKTKTA*
PBR_1026391PBR_10263912F091422MAALMWNSRTQLRSLGGERLHAKYMRGASEEMMASVRLTHAVSDDDYVAVHALATAELGPGLASLEEIKRVDSLTGASIWVIRRNDMVTGFLAPLALTEAGVAALADNTFDAANIDQKWVARLGEPLAGFYCWCYAGKDQVSRGALVLGLRTLIDKHFTDLPFFGRDSTEAGARIMRHLGFFPFDDTPHLFWRCCSLMEPVAC*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.