Scaffold DRAFT_Contig_43006

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold DRAFT_Contig_43006

Scaffold DRAFT_Contig_43006

Overview

Basic Information
Taxon OID	2209111013 Open in IMG/M
Scaffold ID	DRAFT_Contig_43006 Open in IMG/M
Source Dataset Name	Subtropical soil microbial communities from Bundaberg Australia-rainforest
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	Australian Genome Research Facility
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	501
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Subtropical Soil → Subtropical Soil Microbial Communities From Bundaberg Australia

Source Dataset Sampling Location
Location Name	Austrailia: Bundaberg, Queensland
Coordinates	Lat. (^o)	-24.867	Long. (^o)	152.351	Alt. (m)		Depth (m)	0 to .03
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028897	Metagenome / Metatranscriptome	190	Y

Sequences

Protein ID	Family	RBS	Sequence
DRAFT_00056300	F028897	N/A	EEQLGYGTAKAVIASRAVTVHASTLSAPSQELMARA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.