| Basic Information | |
|---|---|
| Family ID | F028897 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 190 |
| Average Sequence Length | 40 residues |
| Representative Sequence | LCEEQLGFGTAKAVIASRAVTVHASTLLAPSQELMARA |
| Number of Associated Samples | 159 |
| Number of Associated Scaffolds | 190 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.08 % |
| % of genes near scaffold ends (potentially truncated) | 97.89 % |
| % of genes from short scaffolds (< 2000 bps) | 87.37 % |
| Associated GOLD sequencing projects | 152 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (87.368 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (10.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (18.947 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.263 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.45% β-sheet: 0.00% Coil/Unstructured: 54.55% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 190 Family Scaffolds |
|---|---|---|
| PF12840 | HTH_20 | 4.74 |
| PF07238 | PilZ | 1.58 |
| PF11799 | IMS_C | 1.58 |
| PF10861 | DUF2784 | 1.05 |
| PF00873 | ACR_tran | 1.05 |
| PF01177 | Asp_Glu_race | 1.05 |
| PF02954 | HTH_8 | 1.05 |
| PF00012 | HSP70 | 1.05 |
| PF01370 | Epimerase | 1.05 |
| PF00753 | Lactamase_B | 0.53 |
| PF00248 | Aldo_ket_red | 0.53 |
| PF07336 | ABATE | 0.53 |
| PF13683 | rve_3 | 0.53 |
| PF12681 | Glyoxalase_2 | 0.53 |
| PF00498 | FHA | 0.53 |
| PF12849 | PBP_like_2 | 0.53 |
| PF03989 | DNA_gyraseA_C | 0.53 |
| PF13650 | Asp_protease_2 | 0.53 |
| PF01769 | MgtE | 0.53 |
| PF00817 | IMS | 0.53 |
| PF02687 | FtsX | 0.53 |
| PF00202 | Aminotran_3 | 0.53 |
| PF12697 | Abhydrolase_6 | 0.53 |
| PF08269 | dCache_2 | 0.53 |
| PF13007 | LZ_Tnp_IS66 | 0.53 |
| PF01987 | AIM24 | 0.53 |
| PF12281 | NTP_transf_8 | 0.53 |
| PF00312 | Ribosomal_S15 | 0.53 |
| PF13185 | GAF_2 | 0.53 |
| PF13852 | DUF4197 | 0.53 |
| PF13545 | HTH_Crp_2 | 0.53 |
| PF00582 | Usp | 0.53 |
| PF13432 | TPR_16 | 0.53 |
| PF00034 | Cytochrom_C | 0.53 |
| PF00491 | Arginase | 0.53 |
| PF11412 | DsbC | 0.53 |
| PF02472 | ExbD | 0.53 |
| PF07786 | HGSNAT_cat | 0.53 |
| PF04542 | Sigma70_r2 | 0.53 |
| PF07681 | DoxX | 0.53 |
| PF16576 | HlyD_D23 | 0.53 |
| PF13581 | HATPase_c_2 | 0.53 |
| PF00027 | cNMP_binding | 0.53 |
| PF01184 | Gpr1_Fun34_YaaH | 0.53 |
| PF02073 | Peptidase_M29 | 0.53 |
| PF11154 | DUF2934 | 0.53 |
| PF14559 | TPR_19 | 0.53 |
| PF08327 | AHSA1 | 0.53 |
| PF02350 | Epimerase_2 | 0.53 |
| PF01740 | STAS | 0.53 |
| PF03992 | ABM | 0.53 |
| COG ID | Name | Functional Category | % Frequency in 190 Family Scaffolds |
|---|---|---|---|
| COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 1.05 |
| COG1584 | Succinate-acetate transporter SatP | Energy production and conversion [C] | 0.53 |
| COG5516 | Uncharacterized conserved protein containing a Zn-ribbon-like motif, possibly RNA-binding | General function prediction only [R] | 0.53 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.53 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.53 |
| COG3503 | Uncharacterized membrane protein, DUF1624 family | Function unknown [S] | 0.53 |
| COG2309 | Leucyl aminopeptidase (aminopeptidase T) | Amino acid transport and metabolism [E] | 0.53 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.53 |
| COG2239 | Mg/Co/Ni transporter MgtE (contains CBS domain) | Inorganic ion transport and metabolism [P] | 0.53 |
| COG2013 | AIM24 protein, required for mitochondrial respiration | Energy production and conversion [C] | 0.53 |
| COG1824 | Permease, similar to cation transporters | Inorganic ion transport and metabolism [P] | 0.53 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.53 |
| COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 0.53 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.53 |
| COG0848 | Biopolymer transport protein ExbD | Intracellular trafficking, secretion, and vesicular transport [U] | 0.53 |
| COG0707 | UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase | Cell wall/membrane/envelope biogenesis [M] | 0.53 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.53 |
| COG0389 | Nucleotidyltransferase/DNA polymerase DinP involved in DNA repair | Replication, recombination and repair [L] | 0.53 |
| COG0381 | UDP-N-acetylglucosamine 2-epimerase | Cell wall/membrane/envelope biogenesis [M] | 0.53 |
| COG0188 | DNA gyrase/topoisomerase IV, subunit A | Replication, recombination and repair [L] | 0.53 |
| COG0184 | Ribosomal protein S15P/S13E | Translation, ribosomal structure and biogenesis [J] | 0.53 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 87.89 % |
| Unclassified | root | N/A | 12.11 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2209111013|DRAFT_Contig_43006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300001356|JGI12269J14319_10040581 | All Organisms → cellular organisms → Bacteria | 2924 | Open in IMG/M |
| 3300005166|Ga0066674_10118858 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
| 3300005174|Ga0066680_10784445 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300005332|Ga0066388_101518996 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1173 | Open in IMG/M |
| 3300005434|Ga0070709_11167200 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300005447|Ga0066689_10320057 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300005450|Ga0066682_10293382 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300005467|Ga0070706_100070915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3223 | Open in IMG/M |
| 3300005468|Ga0070707_100396278 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1340 | Open in IMG/M |
| 3300005536|Ga0070697_101070096 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300005537|Ga0070730_10067302 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2535 | Open in IMG/M |
| 3300005542|Ga0070732_10134888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1466 | Open in IMG/M |
| 3300005557|Ga0066704_10683994 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
| 3300005563|Ga0068855_100679469 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1103 | Open in IMG/M |
| 3300005569|Ga0066705_10386085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 879 | Open in IMG/M |
| 3300005576|Ga0066708_10152333 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
| 3300005576|Ga0066708_10798110 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300006028|Ga0070717_10435321 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1180 | Open in IMG/M |
| 3300006028|Ga0070717_10549796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1045 | Open in IMG/M |
| 3300006052|Ga0075029_100739542 | Not Available | 666 | Open in IMG/M |
| 3300006086|Ga0075019_10540849 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300006173|Ga0070716_101508461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300006354|Ga0075021_10198391 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1224 | Open in IMG/M |
| 3300006755|Ga0079222_10644531 | Not Available | 822 | Open in IMG/M |
| 3300006804|Ga0079221_10155831 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
| 3300006854|Ga0075425_101772140 | Not Available | 694 | Open in IMG/M |
| 3300006871|Ga0075434_100280164 | All Organisms → cellular organisms → Bacteria | 1687 | Open in IMG/M |
| 3300006893|Ga0073928_10006770 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 15267 | Open in IMG/M |
| 3300006893|Ga0073928_10339964 | All Organisms → Viruses → Predicted Viral | 1115 | Open in IMG/M |
| 3300006954|Ga0079219_11135304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes | 668 | Open in IMG/M |
| 3300007076|Ga0075435_100088726 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2549 | Open in IMG/M |
| 3300007982|Ga0102924_1032124 | All Organisms → cellular organisms → Bacteria | 3435 | Open in IMG/M |
| 3300009038|Ga0099829_10366035 | All Organisms → cellular organisms → Bacteria | 1189 | Open in IMG/M |
| 3300009088|Ga0099830_11347753 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
| 3300009090|Ga0099827_11326362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300009090|Ga0099827_11890057 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300009177|Ga0105248_10124563 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2907 | Open in IMG/M |
| 3300009518|Ga0116128_1084510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 952 | Open in IMG/M |
| 3300009519|Ga0116108_1002590 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8694 | Open in IMG/M |
| 3300009520|Ga0116214_1320014 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| 3300009522|Ga0116218_1247098 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 802 | Open in IMG/M |
| 3300009552|Ga0116138_1007907 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 3858 | Open in IMG/M |
| 3300009645|Ga0116106_1254253 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300009839|Ga0116223_10474355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 730 | Open in IMG/M |
| 3300009839|Ga0116223_10740943 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300010083|Ga0127478_1071104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300010134|Ga0127484_1031154 | Not Available | 530 | Open in IMG/M |
| 3300010333|Ga0134080_10403327 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300010341|Ga0074045_10377527 | Not Available | 921 | Open in IMG/M |
| 3300010359|Ga0126376_12182961 | Not Available | 598 | Open in IMG/M |
| 3300010362|Ga0126377_13113740 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300010364|Ga0134066_10080594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 906 | Open in IMG/M |
| 3300010373|Ga0134128_11985793 | Not Available | 640 | Open in IMG/M |
| 3300010373|Ga0134128_12864244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
| 3300010396|Ga0134126_11833624 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 664 | Open in IMG/M |
| 3300010397|Ga0134124_11079019 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 818 | Open in IMG/M |
| 3300011089|Ga0138573_1288240 | Not Available | 992 | Open in IMG/M |
| 3300011120|Ga0150983_12542505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300011120|Ga0150983_13208563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300011120|Ga0150983_13242544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1255 | Open in IMG/M |
| 3300011120|Ga0150983_14571365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 811 | Open in IMG/M |
| 3300012096|Ga0137389_10707287 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 866 | Open in IMG/M |
| 3300012198|Ga0137364_10499908 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300012200|Ga0137382_11291844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300012202|Ga0137363_11532725 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300012205|Ga0137362_11298635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
| 3300012285|Ga0137370_10856629 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
| 3300012357|Ga0137384_11265725 | Not Available | 584 | Open in IMG/M |
| 3300012357|Ga0137384_11309937 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300012362|Ga0137361_11528212 | Not Available | 589 | Open in IMG/M |
| 3300012372|Ga0134037_1210982 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300012373|Ga0134042_1194328 | Not Available | 539 | Open in IMG/M |
| 3300012375|Ga0134034_1010145 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300012382|Ga0134038_1227654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 769 | Open in IMG/M |
| 3300012393|Ga0134052_1248006 | Not Available | 674 | Open in IMG/M |
| 3300012395|Ga0134044_1168868 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300012397|Ga0134056_1290479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales | 1441 | Open in IMG/M |
| 3300012917|Ga0137395_10417535 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 962 | Open in IMG/M |
| 3300012917|Ga0137395_11020061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
| 3300012929|Ga0137404_11098048 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 730 | Open in IMG/M |
| 3300012930|Ga0137407_11310211 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 688 | Open in IMG/M |
| 3300012960|Ga0164301_11133639 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 624 | Open in IMG/M |
| 3300012972|Ga0134077_10141020 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300013772|Ga0120158_10422345 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
| 3300014152|Ga0181533_1198092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 778 | Open in IMG/M |
| 3300014502|Ga0182021_12656111 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300016702|Ga0181511_1315758 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium → Silvibacterium bohemicum | 3367 | Open in IMG/M |
| 3300016705|Ga0181507_1099683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300016730|Ga0181515_1171533 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300016750|Ga0181505_10223067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1651 | Open in IMG/M |
| 3300016750|Ga0181505_10365693 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 583 | Open in IMG/M |
| 3300017656|Ga0134112_10083845 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
| 3300017823|Ga0187818_10511665 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300017925|Ga0187856_1004962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8658 | Open in IMG/M |
| 3300017925|Ga0187856_1235180 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
| 3300017933|Ga0187801_10471622 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300017940|Ga0187853_10387572 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300017943|Ga0187819_10240695 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1061 | Open in IMG/M |
| 3300017955|Ga0187817_10109212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1745 | Open in IMG/M |
| 3300017955|Ga0187817_10790544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300017955|Ga0187817_10965431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300017955|Ga0187817_11097047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300017970|Ga0187783_10116120 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1973 | Open in IMG/M |
| 3300017970|Ga0187783_11098730 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
| 3300017972|Ga0187781_11454966 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300018001|Ga0187815_10146962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 997 | Open in IMG/M |
| 3300018007|Ga0187805_10563038 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300018023|Ga0187889_10010060 | All Organisms → cellular organisms → Bacteria | 6438 | Open in IMG/M |
| 3300018023|Ga0187889_10011059 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6037 | Open in IMG/M |
| 3300018062|Ga0187784_10254177 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1430 | Open in IMG/M |
| 3300018085|Ga0187772_10249518 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1205 | Open in IMG/M |
| 3300018085|Ga0187772_10666388 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300018085|Ga0187772_11362314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300018085|Ga0187772_11401407 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300018088|Ga0187771_10147557 | All Organisms → cellular organisms → Bacteria | 1931 | Open in IMG/M |
| 3300018431|Ga0066655_10357574 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300018468|Ga0066662_12054658 | Not Available | 598 | Open in IMG/M |
| 3300018482|Ga0066669_12291443 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300019789|Ga0137408_1054399 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
| 3300019888|Ga0193751_1198282 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 674 | Open in IMG/M |
| 3300021420|Ga0210394_10152193 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2010 | Open in IMG/M |
| 3300021479|Ga0210410_11342901 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
| 3300021559|Ga0210409_10244329 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1626 | Open in IMG/M |
| 3300021560|Ga0126371_10469026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1406 | Open in IMG/M |
| 3300021560|Ga0126371_12889107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300021858|Ga0213852_1065152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300022523|Ga0242663_1013887 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1128 | Open in IMG/M |
| 3300022712|Ga0242653_1064235 | Not Available | 619 | Open in IMG/M |
| 3300022717|Ga0242661_1068312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 695 | Open in IMG/M |
| 3300022717|Ga0242661_1087298 | Not Available | 637 | Open in IMG/M |
| 3300022726|Ga0242654_10282819 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
| 3300025442|Ga0208034_1002774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8702 | Open in IMG/M |
| 3300025459|Ga0208689_1002508 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8705 | Open in IMG/M |
| 3300025910|Ga0207684_10183033 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1807 | Open in IMG/M |
| 3300025913|Ga0207695_10292476 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1521 | Open in IMG/M |
| 3300025916|Ga0207663_11037088 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
| 3300025917|Ga0207660_10568113 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 923 | Open in IMG/M |
| 3300025922|Ga0207646_11238850 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300025925|Ga0207650_10801116 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 798 | Open in IMG/M |
| 3300025929|Ga0207664_10872153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 809 | Open in IMG/M |
| 3300025929|Ga0207664_10988831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 754 | Open in IMG/M |
| 3300025938|Ga0207704_10521685 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 961 | Open in IMG/M |
| 3300025939|Ga0207665_10587079 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300026277|Ga0209350_1013328 | All Organisms → cellular organisms → Bacteria | 2608 | Open in IMG/M |
| 3300026307|Ga0209469_1083567 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300026313|Ga0209761_1301556 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300026322|Ga0209687_1043255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1465 | Open in IMG/M |
| 3300026343|Ga0209159_1017580 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4098 | Open in IMG/M |
| 3300026499|Ga0257181_1060611 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300026538|Ga0209056_10039406 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4352 | Open in IMG/M |
| 3300026984|Ga0208732_1027702 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300027576|Ga0209003_1069206 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300027905|Ga0209415_10891403 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300027911|Ga0209698_10143283 | All Organisms → cellular organisms → Bacteria | 1965 | Open in IMG/M |
| 3300028016|Ga0265354_1009825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 917 | Open in IMG/M |
| 3300028536|Ga0137415_11055911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_2_20CM_2_66_6 | 625 | Open in IMG/M |
| 3300030618|Ga0311354_11518879 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300030836|Ga0265767_108873 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 657 | Open in IMG/M |
| 3300030973|Ga0075395_11363882 | Not Available | 560 | Open in IMG/M |
| 3300031017|Ga0265744_111045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300031231|Ga0170824_103979494 | Not Available | 843 | Open in IMG/M |
| 3300031231|Ga0170824_110736065 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1842 | Open in IMG/M |
| 3300031241|Ga0265325_10444774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 565 | Open in IMG/M |
| 3300031474|Ga0170818_114510518 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 816 | Open in IMG/M |
| 3300031718|Ga0307474_10709813 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 794 | Open in IMG/M |
| 3300031823|Ga0307478_11171070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 641 | Open in IMG/M |
| 3300031823|Ga0307478_11360723 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
| 3300031833|Ga0310917_11168457 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300031879|Ga0306919_10281472 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
| 3300031941|Ga0310912_10038661 | All Organisms → cellular organisms → Bacteria | 3294 | Open in IMG/M |
| 3300031962|Ga0307479_10557175 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1129 | Open in IMG/M |
| 3300032041|Ga0318549_10491638 | Not Available | 552 | Open in IMG/M |
| 3300032072|Ga0326631_105910 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 734 | Open in IMG/M |
| 3300032072|Ga0326631_106514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 712 | Open in IMG/M |
| 3300032180|Ga0307471_103855053 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300032205|Ga0307472_101588714 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
| 3300032205|Ga0307472_102395761 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300032805|Ga0335078_11166201 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 893 | Open in IMG/M |
| 3300032892|Ga0335081_12605533 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300032898|Ga0335072_10745729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 948 | Open in IMG/M |
| 3300033134|Ga0335073_10336868 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1793 | Open in IMG/M |
| 3300033134|Ga0335073_10553394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1298 | Open in IMG/M |
| 3300033134|Ga0335073_10661478 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1151 | Open in IMG/M |
| 3300033134|Ga0335073_11701240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 595 | Open in IMG/M |
| 3300034664|Ga0314786_147423 | Not Available | 548 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 6.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.32% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.79% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.26% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.74% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.21% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.68% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.68% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.68% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.68% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.16% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.63% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.11% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.11% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.11% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.58% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.58% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.58% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.58% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.05% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.05% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.05% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.05% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.53% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.53% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.53% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.53% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.53% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.53% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.53% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.53% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.53% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.53% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.53% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.53% |
| Subtropical Soil | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Subtropical Soil | 0.53% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2209111013 | Subtropical soil microbial communities from Bundaberg Australia-rainforest | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
| 3300009641 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010083 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010134 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300011089 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 58 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012372 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012373 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012375 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012382 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012393 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012395 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012397 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300014152 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016705 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016730 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021858 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022712 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023678 | Metatranscriptome of spruce litter microbial communities from Bohemian Forest, Czech Republic - CLA4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025442 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025459 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026984 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF048 (SPAdes) | Environmental | Open in IMG/M |
| 3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030973 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031017 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032072 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSI2 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300034664 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DRAFT_00056300 | 2209111013 | Subtropical Soil | EEQLGYGTAKAVIASRAVTVHASTLSAPSQELMARA |
| JGI12269J14319_100405818 | 3300001356 | Peatlands Soil | GKNRRLCEEELGFGTAKAVIASRAVTVHVSTLLAPSQELVARA* |
| Ga0066674_101188583 | 3300005166 | Soil | PEKTDGLCEEPLGFGTAKAVITSRAVMVHASTLLAPSQELVAGA* |
| Ga0066680_107844452 | 3300005174 | Soil | PEKTDGLCEEPLGFGTAKAVITSRAVMVHASTLLAPSQEPVAGA* |
| Ga0066388_1015189961 | 3300005332 | Tropical Forest Soil | RPEKTD*LCEEQLGFGTAKAVIASEAVMVHASTLLAPSQEPATRA* |
| Ga0070709_111672001 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | WLCEEQLGFGTAKAVIASGVVTVHASTLLAPSQELMTRA* |
| Ga0066689_103200573 | 3300005447 | Soil | EKTDGLCEEPLGFGTAKAVITSRAVMVHASTLLAPSQELVAGA* |
| Ga0066682_102933822 | 3300005450 | Soil | KSDQTEKTDGLCEEPLGFGTAKAVITSRAVMVHASTLLAPSQELVVGA* |
| Ga0070706_1000709151 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | TRPEKTDWFCEEQLGFGTAKAVIASRAATVHASMLLAPSQEFAAGA* |
| Ga0070707_1003962783 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | PEKTDWLCEEQLGFGTAKAVIASGVVTVHASTLLAPSQELAARA* |
| Ga0070697_1010700963 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | PEKTDGLCEEPLGFGTAKAVITSRAVMVHASTPLAPSQELVAGA* |
| Ga0070730_100673025 | 3300005537 | Surface Soil | ATRPEKTDWFCEEQLGFGSAKAVIASRAATVHASTRLAPSQELMAGA* |
| Ga0070732_101348884 | 3300005542 | Surface Soil | EEQLGFGTAKAVIASRAVTVHASTLSASSQELMARA* |
| Ga0066704_106839942 | 3300005557 | Soil | CEEQLGSGTAKAVIASRAAMVHVSTLLALSQELVAGA* |
| Ga0068855_1006794691 | 3300005563 | Corn Rhizosphere | PEKTNGLCEEQLGFGTAKAVIASGAVTVHASTLLTPSQELAARA* |
| Ga0066705_103860851 | 3300005569 | Soil | LCEEQLGFGTAKAVITSRAAMVHVSTLLASSQELAARA* |
| Ga0066708_101523331 | 3300005576 | Soil | LCEEWLGFGTAKAVITSGAVMVHASTLYASSQEASG* |
| Ga0066708_107981101 | 3300005576 | Soil | EKTDGLCEEPLGFGTAKAVITSRAVMVHASTLLAPSQELVVGA* |
| Ga0070717_104353211 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | PEKTDCFCEEQLGFGTAKAVIASRAATVHASTLLAPSQELAAGA* |
| Ga0070717_105497961 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LCEEQLGFGTAKAVITSRAATVHVSTLLASSQEPVARA* |
| Ga0075029_1007395422 | 3300006052 | Watersheds | KNRRLCEEKLGFGTAKAVIASGAVTVHASTLWAPSQELAARA* |
| Ga0075019_105408492 | 3300006086 | Watersheds | LCEEELGFGTAKAVIASRAVTVHASTLLAPSQELAARA* |
| Ga0070716_1015084611 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | KNRRICEVQLGFGTAKAVIAQGVVTVHASTLLAPSQELAARA* |
| Ga0075021_101983911 | 3300006354 | Watersheds | LCEEEPGFGTAKAVIASGAAAVHASRLSALSQESMARA* |
| Ga0079222_106445311 | 3300006755 | Agricultural Soil | RKNRRLCEEQSGSGTAKAVIASGAAMVHVSTLPAPSQELVARA* |
| Ga0079221_101558311 | 3300006804 | Agricultural Soil | QSGSGTAKAVIASGAAMVHVSTLPAPSQELVAGA* |
| Ga0075425_1017721402 | 3300006854 | Populus Rhizosphere | QLCEEWLGFGTAKAVITSGAVMVHVSTLFASSQEASG* |
| Ga0075434_1002801641 | 3300006871 | Populus Rhizosphere | LCEEWLGFGTAKAVITSGAVMVHVSTLFASSQEASG* |
| Ga0073928_100067701 | 3300006893 | Iron-Sulfur Acid Spring | RPEKTDWLCEEQLGFGTAKAVIASGVVTVHASTLLAPSQEPAARA* |
| Ga0073928_103399641 | 3300006893 | Iron-Sulfur Acid Spring | KTDWLCEEQLGFGTAKAVIASGVVTVHASTLLAPSQELAARA* |
| Ga0079219_111353041 | 3300006954 | Agricultural Soil | VTRPEKTGGHCEVQPGFGTAKAVIASGTVTVHVSTLVTPSQELLAGA* |
| Ga0075435_1000887267 | 3300007076 | Populus Rhizosphere | CEEQLGFGTAKAVITSGAVMVHASTLLASSQEAGD* |
| Ga0102924_10321246 | 3300007982 | Iron-Sulfur Acid Spring | RATRPEKTGRLCEEELGFGTAKAAIASRAATVHGSTPWAPSQEQMAGT* |
| Ga0099829_103660351 | 3300009038 | Vadose Zone Soil | NRQLCEEWLGFGTAKAVITSGAVMVHASTLLASS* |
| Ga0099830_113477532 | 3300009088 | Vadose Zone Soil | QLGFGTAKAVIASGVVTVHASTLLAPSQELMTRA* |
| Ga0099827_113263623 | 3300009090 | Vadose Zone Soil | ARPEKTDWLCEEQLGFGTAKAVIASGVVTVHASTLLAPSQELAARA* |
| Ga0099827_118900572 | 3300009090 | Vadose Zone Soil | LCEGQLGFGTAKAVIASRAVTVHASTLLAPSQELMARA* |
| Ga0105248_101245631 | 3300009177 | Switchgrass Rhizosphere | KTNGLCEEQLGFGTAKAVIASGAVTVHASTLLTPSQELAARA* |
| Ga0116128_10845101 | 3300009518 | Peatland | KNRRLCEGQLGFGTAKAVIASRAVTVHVSTLLAPSQELMARA* |
| Ga0116108_10025901 | 3300009519 | Peatland | GQLGFGTAKAVIASRAVTVRASTLLAPSQELMARA* |
| Ga0116214_13200141 | 3300009520 | Peatlands Soil | KNRRLCEEKLGFGTAKAVIASKGCDGACSTLLAPSQELAARA* |
| Ga0116218_12470981 | 3300009522 | Peatlands Soil | LCEGQLGFGTAKAVIASRAVTVHASTLLAPSQELTARA* |
| Ga0116138_10079075 | 3300009552 | Peatland | EEQLGFGTAKAVIASRAVTVHVSTLLAPSQELVARA* |
| Ga0116120_11165321 | 3300009641 | Peatland | PEGTARPEKTDCAARCQPGFGTAKAVIASKAVTVHASTLVTPSQELAARA* |
| Ga0116106_12542532 | 3300009645 | Peatland | REDQLGFGTAKAVIASGAVTVHASTLLTPSQESAARA* |
| Ga0116223_104743552 | 3300009839 | Peatlands Soil | LCEGQLGFGTAKAVIASRAVTVHASTLLAPSQELAARA* |
| Ga0116223_107409431 | 3300009839 | Peatlands Soil | RLCEEELGFGTAKAVIASRAVTVHVSTLLGPSQELMARA* |
| Ga0127478_10711041 | 3300010083 | Grasslands Soil | KTDGLCEEPLGFGTAKAVITSRAVMVHASTLLAPSQELVAATSGMAYAA* |
| Ga0127484_10311541 | 3300010134 | Grasslands Soil | EGELGFGTAKAAIAPRVATVHVSTLLTLSQELADGA* |
| Ga0134080_104033271 | 3300010333 | Grasslands Soil | RPEKTDGLCEEPLGFGTAKAVITSRAVMVHASTLLAPSQELVAGA* |
| Ga0074045_103775271 | 3300010341 | Bog Forest Soil | EGQLGFGTAKAVIASKAVTAHASTLLAPSQELTARA* |
| Ga0126376_121829611 | 3300010359 | Tropical Forest Soil | EEELGSGTAKAVIASRAVTVHASTLLTPSQELPARA* |
| Ga0126377_131137401 | 3300010362 | Tropical Forest Soil | SCEGRLGFGTVKAVITSGVVTVHVSTLLALSQELAARA* |
| Ga0134066_100805941 | 3300010364 | Grasslands Soil | VQLGFGTAKAVIASGAVTVHVSTSVTPSQELLAGA* |
| Ga0134128_119857931 | 3300010373 | Terrestrial Soil | LCEEWLGFGTAKAVITSGAVMVHASTLVASSQGANG* |
| Ga0134128_128642442 | 3300010373 | Terrestrial Soil | QLGFGTAKAVITSRAATVHVSTLLASSQELVARA* |
| Ga0134126_118336241 | 3300010396 | Terrestrial Soil | RLGPGTAKAVITSKVAAVHASELLALSQEQAARA* |
| Ga0134124_110790191 | 3300010397 | Terrestrial Soil | RPEKTNGLCEEQLGFGTAKAVIASGAVTVHASTLLTPSQELPARA* |
| Ga0138573_12882401 | 3300011089 | Peatlands Soil | GQLGFGTAKAVIASRAVTVRVSTLLAPSQELAARAAQTVHV* |
| Ga0150983_125425051 | 3300011120 | Forest Soil | GQLGFGTAKAVIASRAVTVHASTLKAPSQELAARA* |
| Ga0150983_132085631 | 3300011120 | Forest Soil | EGSLGFGTAKAVIASRAVTVHASTLLAPSQELAARA* |
| Ga0150983_132425442 | 3300011120 | Forest Soil | EEWLGFGTAKAAIASRAVMVHASTLMTPSQESAARA* |
| Ga0150983_145713651 | 3300011120 | Forest Soil | KTDWLCEEKLGFGTAKAVITSRAATVHVSTRLALSQELMAGA* |
| Ga0137389_107072871 | 3300012096 | Vadose Zone Soil | LCEEWLGFGTAKAVITSGAVMVHASTLLASSQGASG* |
| Ga0137364_104999081 | 3300012198 | Vadose Zone Soil | EKTDGLCEEPLGFGTAKAVITSRAVMVHASTLLASSQELVAGA* |
| Ga0137382_112918441 | 3300012200 | Vadose Zone Soil | QLGFGTAKAVIASRAVTVHASTLLAPSQELAARA* |
| Ga0137363_115327252 | 3300012202 | Vadose Zone Soil | LCEEQLGFGTAKAVIASRAVTVHASTLLAPSQELMARA* |
| Ga0137362_112986352 | 3300012205 | Vadose Zone Soil | FCEEQLGFGTAKAVIASRAATVHASALLTLSQELAAGA* |
| Ga0137370_108566291 | 3300012285 | Vadose Zone Soil | PEKTDWFCEEQLGSGTAKAVIASRAAMVHVSTLLALSQELVAGA* |
| Ga0137384_112657251 | 3300012357 | Vadose Zone Soil | EEWLGFGTAKAVITSGAVMVHVSTLLASSQGVSG* |
| Ga0137384_113099372 | 3300012357 | Vadose Zone Soil | AARPEKTDWLCEEQLGFGTAKAVIASGVVTVHASTLLAPSQELAARA* |
| Ga0137361_115282121 | 3300012362 | Vadose Zone Soil | KNRQLCEEWLGFGTAKAVITSGAVMVHASTLLASSQEASG* |
| Ga0134037_12109821 | 3300012372 | Grasslands Soil | PEKTDGLCEEPLGFGTAKAVITSRAVMVHASTLLAPSQELGYYLLSSQ* |
| Ga0134042_11943281 | 3300012373 | Grasslands Soil | KTDGLCEEPLGFGTAKAVITSRAVMVHASTLLAPSQELVAVIVA* |
| Ga0134034_10101451 | 3300012375 | Grasslands Soil | DGLCEEPLGFGTAKAVITSRAVMVHASTLLAPSQELVAGLAPIK* |
| Ga0134038_12276541 | 3300012382 | Grasslands Soil | SEEQLGFGTAKAVITSRAATVRVSTLLASSQELVAERLAT* |
| Ga0134052_12480062 | 3300012393 | Grasslands Soil | FCEVQPGFGAAKAAIASGVVTVHVSTLLASSQELAARL* |
| Ga0134044_11688681 | 3300012395 | Grasslands Soil | TRPEKTDGLCEEPLGFGTAKAVITSRAVMVHASTLVAPSQAAKCDT* |
| Ga0134056_12904791 | 3300012397 | Grasslands Soil | KTDGLCEEPLGFGTAKAVITSRAVMVHASTLLAPSQEPVAGLSLL* |
| Ga0137395_104175353 | 3300012917 | Vadose Zone Soil | EVQPGFGAAKAAIASGVVTVHVSTLLASSQELAARA* |
| Ga0137395_110200611 | 3300012917 | Vadose Zone Soil | DWLCEEQLGSGTAKAVIASGVVTVHASTLLAPSQELAARA* |
| Ga0137404_110980481 | 3300012929 | Vadose Zone Soil | RPEKTDCSCEGQLGFGTAKAVVASRAVTVHASTLLASSQELMARA* |
| Ga0137407_113102111 | 3300012930 | Vadose Zone Soil | RQLCEEWLGFGTAKAVITSGAVMVHASTLLASSQGASG* |
| Ga0164301_111336391 | 3300012960 | Soil | QLGFGTAKAVIASRAVTVHVSTLLTPSQELATGA* |
| Ga0134077_101410202 | 3300012972 | Grasslands Soil | EEPLGFGTAKAVITSRAVMVHASTLLAPSQEPVAGA* |
| Ga0120158_104223451 | 3300013772 | Permafrost | EQLGFGTAKAVIASRAVTVHVSTRLTPSQELAARA* |
| Ga0181533_11980922 | 3300014152 | Bog | CEEQLGFGTAKAVIASRAVTVHVSTLLAPSQELMARA* |
| Ga0181523_106552131 | 3300014165 | Bog | GTARPEKTDCAARCQPGFGTAKAVIASKAVTVHASTLVTPSQELAARA* |
| Ga0182021_126561111 | 3300014502 | Fen | KNRPLCEEELGFGTAKAVIASRAVTVHVSTLLASSQELMARA* |
| Ga0181511_13157581 | 3300016702 | Peatland | KTDCTARCQPGFGTAKAVIASRAVTVHASTLVTPSQELAARA |
| Ga0181507_10996832 | 3300016705 | Peatland | MFTNRRLCEGQLGFGTAKAVIASRAVTVHASTLLAPSQEL |
| Ga0181515_11715331 | 3300016730 | Peatland | NRRLCEGQLGFGTAKAVIASRAVTVHVSTRLAPSQELAASWQ |
| Ga0181505_102230674 | 3300016750 | Peatland | CEGQLGFGTAKAVIASRAVTVHVSTLLAPSQELMARA |
| Ga0181505_103656931 | 3300016750 | Peatland | LTGVEKNRRLCEGQLGFGTAKAVIASRAVTVHVSTLLAPSQERM |
| Ga0134112_100838453 | 3300017656 | Grasslands Soil | PEKTDGLCEEPLGFGTAKAVITSRAVMVHASTLLAPSQEPVAGA |
| Ga0187818_105116651 | 3300017823 | Freshwater Sediment | EKTDCFCEEQLGFGTAKAVIASRAVTVHVSTLLTPSQELAARA |
| Ga0187856_10049621 | 3300017925 | Peatland | GQLGFGTAKAVIASRAVTVRASTLLAPSQELMARA |
| Ga0187856_12351802 | 3300017925 | Peatland | LCEGQLGFGTAKAVIASRAVTVHASTLLAPSQELMARA |
| Ga0187801_104716221 | 3300017933 | Freshwater Sediment | LRERRLGFGTAKAVIASGAVTVHVSTSLTPSQEPAAGT |
| Ga0187853_103875721 | 3300017940 | Peatland | LCEGQLGFGTAKAVIASRAVTVHASTLLTPSQELVARA |
| Ga0187819_102406951 | 3300017943 | Freshwater Sediment | GPEKTDCFCEEQLGFGTAKAVIASRAATVRASTLLAPSQELADGA |
| Ga0187817_101092121 | 3300017955 | Freshwater Sediment | EKTDNLRERRLGFGTAKAVIASGAVTVHVSTSLTPSQEPAAGT |
| Ga0187817_107905442 | 3300017955 | Freshwater Sediment | PEKTDWFCEEQLGFGTAKAVIASRAVTVHVSTLLTPSQELAARA |
| Ga0187817_109654312 | 3300017955 | Freshwater Sediment | LCEEKLGFGTAKAVIASKGCDGACSTLLAPSQELVARA |
| Ga0187817_110970471 | 3300017955 | Freshwater Sediment | EGELGFGTAKAVIASGAATVHVSTLLTPSQELVARA |
| Ga0187783_101161201 | 3300017970 | Tropical Peatland | KNRLLCEEQVGFGTAKAVIASEAVTVRASTLSAPSQELGARA |
| Ga0187783_110987302 | 3300017970 | Tropical Peatland | CEEELGFGTAKAAIASRAATVHVSTLWVLSQEQMAGA |
| Ga0187781_114549661 | 3300017972 | Tropical Peatland | EETPGFGTAKAVIASKAVTVHASTLPTLSQELAARA |
| Ga0187815_101469621 | 3300018001 | Freshwater Sediment | TRKNRLPCEEQLGFGTAKAVIASGAATVRASTLSALSRETVARA |
| Ga0187805_105630381 | 3300018007 | Freshwater Sediment | EEPGFGTVKTVIASRAATVHVSTLSASSQELAARA |
| Ga0187889_100100609 | 3300018023 | Peatland | EKSDCFREDQLGFGTAKAVIASGAVTVHASTLLTPSQESAVRA |
| Ga0187889_100110591 | 3300018023 | Peatland | EKSDCFREDQLGFGTAKAVIASGAVTVHASTLLTPSQESAARA |
| Ga0187784_102541771 | 3300018062 | Tropical Peatland | DVLCEDALGSGTAKAVIASGAVTVHVSTLFAPSQELAARA |
| Ga0187772_102495181 | 3300018085 | Tropical Peatland | TSRPEKSDVICEDALGFGTAKAVIASGAVTVHASTLLAPSQVPVARA |
| Ga0187772_106663882 | 3300018085 | Tropical Peatland | PEKTDVLCEDALGSGTAKAVIASGAVTVHASTLLAPSQESAARA |
| Ga0187772_113623141 | 3300018085 | Tropical Peatland | DVLCEDTLGSGAAKAVVASGAVTVHVSTLFAPSQELAARA |
| Ga0187772_114014071 | 3300018085 | Tropical Peatland | KTDRLCEEQLGFGTAKAVIASRAVTVHASTLSASSQELVARA |
| Ga0187771_101475571 | 3300018088 | Tropical Peatland | TRPEKTDSLRERLLGFGTAKAVVASGAVTVHVSTLLTPSQELAARA |
| Ga0066655_103575741 | 3300018431 | Grasslands Soil | PEKTDGLCEEPLGFGTAKAVITSRAVMVHASTLLAPSQELVVGA |
| Ga0066662_120546581 | 3300018468 | Grasslands Soil | REQQLGFGTVKAVIASRAATVPASTLLALSQELAARA |
| Ga0066669_122914431 | 3300018482 | Grasslands Soil | EGQLGFGTAKAVIASRAVTVHASTLLAPSQELMDRA |
| Ga0137408_10543991 | 3300019789 | Vadose Zone Soil | EVQPGFGTAKAVVASRVVTVHVSTLLAPSQELAARA |
| Ga0193751_11982821 | 3300019888 | Soil | LCEGQLGFGTAKAVIASGVVTVHASTLLAPSQELATRA |
| Ga0210394_101521933 | 3300021420 | Soil | LCEGQLGFGTAKAVIASRAVTVHASTLLAPSQELAARA |
| Ga0210410_113429011 | 3300021479 | Soil | RPEKTDWICEEQLGFGTAKAVIASGAVTVRASTLLTPSQESVARA |
| Ga0210409_102443293 | 3300021559 | Soil | LLCEEELGFGTAKAVITSGAVMVHASTLWASSQELMARA |
| Ga0126371_104690263 | 3300021560 | Tropical Forest Soil | EKQLGFGTAKAVIASKAATVHASTLSASSQELAARA |
| Ga0126371_128891072 | 3300021560 | Tropical Forest Soil | LCEEQLGFGTAKAVIASGVVTVHASTLLASSQELMVRA |
| Ga0213852_10651521 | 3300021858 | Watersheds | TRKNRRHCEVQLGFGTAKAVVASKAMMVRVSTLVTLSQELAARA |
| Ga0242663_10138872 | 3300022523 | Soil | EKTDWICEEQLGFGTAKAVIASGAVTVRASTLLTPSQESAARA |
| Ga0242653_10642351 | 3300022712 | Soil | EEQLGFGTAKAVIASRAVTVHASTLLASSQEQAARA |
| Ga0242661_10683121 | 3300022717 | Soil | VTRPEKSGGHCDVQPGFGTEKPVIASGAVTVHASTLLTPSRE |
| Ga0242661_10872981 | 3300022717 | Soil | KNRRLCEGQLGFGTAKAVIASRAVTVHASTLKAPSQELAARA |
| Ga0242654_102828193 | 3300022726 | Soil | CEGQLGFGTAKAVIASRAVTVHASTLLAPSQELAVRA |
| Ga0247538_1047301 | 3300023678 | Soil | VGAARPEKTDCAARCQPGCGTAKAVIASRAVTVRASTLVTPSQELAA |
| Ga0208034_10027741 | 3300025442 | Peatland | EGQLGFGTAKAVIASRAVTVRASTLLAPSQELMARA |
| Ga0208689_10025081 | 3300025459 | Peatland | CEGQLGFGTAKAVIASRAVTVRASTLLAPSQELMARA |
| Ga0207684_101830331 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | EQLGFGTAKAVIASGVVTVHASTLLAPSQELATRA |
| Ga0207695_102924761 | 3300025913 | Corn Rhizosphere | EEQLGFGTAKAVIASRAATVHVSTQLALSQELADGA |
| Ga0207663_110370881 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | DPKKPADFCEEEPGFGIAKAVIASRAVTVHASTLLAPSQELAARA |
| Ga0207660_105681133 | 3300025917 | Corn Rhizosphere | RPEKTDCFCEEQLGFGTVKAVIASRAATVHVSTQLALSQELADGA |
| Ga0207646_112388501 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | PEKTDWLCEEQLGFGTAKAVIASGVVTVHASTLLAPSQELAARA |
| Ga0207650_108011162 | 3300025925 | Switchgrass Rhizosphere | ATRPEKTNGLCEEQLGFGTAKAVIASGAVTVHASTLLTPSQELAARA |
| Ga0207664_108721533 | 3300025929 | Agricultural Soil | TGPEKTDCFCEEQLGFGTAKAVIASRAATVHVSTQLALSQELADGA |
| Ga0207664_109888311 | 3300025929 | Agricultural Soil | DCFCEEQLGFGTAKAVVASRAATVHASTLLSPSQELAAGA |
| Ga0207704_105216851 | 3300025938 | Miscanthus Rhizosphere | EEQLGFGTAKAVIASRAVTVHASTQLASSQELAARA |
| Ga0207665_105870792 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | EKTGGHCEVQPGFGTAKAVIASGAVTVHVSTLLTPSQEPAAGA |
| Ga0209350_10133284 | 3300026277 | Grasslands Soil | EEPLGFGTAKAVITSRAVMVHASTLVAPSQELVAGA |
| Ga0209469_10835671 | 3300026307 | Soil | ATRPEKTDGLCEEPLGFGTAKAVITSRAVMVHASTLLAPSQELVAGA |
| Ga0209761_13015562 | 3300026313 | Grasslands Soil | EKTDGLCEEPLGFGTAKAVITSRAVMVHASTLVAPSQELVAGA |
| Ga0209687_10432552 | 3300026322 | Soil | CEVQPGFGTAQAVIASGAVTVHVSTLLTPSQEPTAGA |
| Ga0209159_10175801 | 3300026343 | Soil | EKTDGLCEEPLGFGTAKAVITSRAVMVHASTLLAPSQELVAGA |
| Ga0257181_10606112 | 3300026499 | Soil | KNRLFCEVQPGFGTAKAVVASRVVMVHVSTLLAPSQELAARA |
| Ga0209056_100394061 | 3300026538 | Soil | RPEKTDGLCEEPLGFGTAKAVITSRAVMVHASTLLAPSQELVAGA |
| Ga0208732_10277022 | 3300026984 | Forest Soil | RPEKTDWLCEEKLGFGTAKAVITSRAATVHVSTRLALSQELMAGA |
| Ga0209003_10692062 | 3300027576 | Forest Soil | GPEKTDCFCEEQLGSETAKAVIASRAATVHASTLWALSQEQMAGA |
| Ga0209415_108914032 | 3300027905 | Peatlands Soil | CEGQLGFGTAKAVIASRAVTVHASTLLAPPQELVARA |
| Ga0209698_101432831 | 3300027911 | Watersheds | AARPEKTDCLCEEQLGFGTAKAVIASKAVTVHVSTLLAPSQELAARA |
| Ga0265354_10098251 | 3300028016 | Rhizosphere | TDWICEEQLGFGTAKAVIASGAVTVRASTLLTPSQESVARA |
| Ga0137415_110559111 | 3300028536 | Vadose Zone Soil | RPEKTDGLCEEQLGFGTAKAVITSRAVMVHASTLLAPSQELVAGA |
| Ga0311354_115188793 | 3300030618 | Palsa | RLCEEQLGSGTAKAVIASKAVTVHASTLLAPSQELTARA |
| Ga0265767_1088731 | 3300030836 | Soil | EGQLGFGTAKAVIASRAVTVHASTLKAPSQELAARA |
| Ga0265769_1121762 | 3300030888 | Soil | VIGSAGHPAASARPEKSDCTARCQPGSGAAKAEIAPRAVTVHASTPVAPSQELAARP |
| Ga0075395_113638821 | 3300030973 | Soil | CEEQLGFGTAKAVIASRAATVHASTLLTPSQELMAGA |
| Ga0265744_1110452 | 3300031017 | Soil | KNRRLCEGQLGFGTAKAVIASRAVTVHVSTLLTPSQEPVL |
| Ga0170824_1039794941 | 3300031231 | Forest Soil | EQLGFGTVKTVIASRAVTVHASTLLAPSQELAARA |
| Ga0170824_1107360651 | 3300031231 | Forest Soil | AARPEKKRRLCEGQLGFGTAKAVIASRAVMVHASTLLAPSQELAVRA |
| Ga0265325_104447743 | 3300031241 | Rhizosphere | GQLGFGTAKAVIASRAVTVHASTLLAPSQELAARA |
| Ga0170818_1145105181 | 3300031474 | Forest Soil | KTDWICEEQLGFGTVKAVIASRAVTVHASTRLTPSQELAARA |
| Ga0307474_107098132 | 3300031718 | Hardwood Forest Soil | EKTDWLCEEKLGFGTAKAVITSRAATVHVSTRLALSQELMAGA |
| Ga0307478_111710701 | 3300031823 | Hardwood Forest Soil | RPEKTDCFCEEQLGFGTAKAVIASRAATVHASTLLAPSQELMAGA |
| Ga0307478_113607231 | 3300031823 | Hardwood Forest Soil | RPEKTDCFCEEQLGFGTAKAVIASRAATVHASRLLAPSQELAAGA |
| Ga0310917_111684572 | 3300031833 | Soil | RPEKTDCFCEEQLGFGTAKAAIASRAVTVHASTLSAPSQEQMAGA |
| Ga0306919_102814723 | 3300031879 | Soil | EEQLGFGTAKAAIASRAVTVHASTLSAPSQEQMAGA |
| Ga0310912_100386616 | 3300031941 | Soil | EEQLGFGTAKAVIASRAVTVHASTLIASSQELAARA |
| Ga0307479_105571751 | 3300031962 | Hardwood Forest Soil | CEEQLGFGTAKAVITSKAAAVHDSTLLAPSQELVARA |
| Ga0318549_104916382 | 3300032041 | Soil | CEPGFGTAKAVIAPGAVTVHASTPGSPSQESLARA |
| Ga0326631_1059101 | 3300032072 | Soil | CEGQLGFGTAKAVIASRAVTVHASTLKAPSQELAARA |
| Ga0326631_1065142 | 3300032072 | Soil | EKTDDLCEEPPGFGTAKAAITSRTATVHASTPQTPSQE |
| Ga0307471_1038550532 | 3300032180 | Hardwood Forest Soil | EEEPGFGTAKAAIASRAATVHVSTLLALSQEPSAGA |
| Ga0307472_1015887141 | 3300032205 | Hardwood Forest Soil | FCEEQLGSGPAKAVIASRAVTVHASTLWAPSQELAARA |
| Ga0307472_1023957612 | 3300032205 | Hardwood Forest Soil | PKKPADSREEEPGFGTAKAVIASRAATVHVSTLLALSQEPIAGA |
| Ga0335078_111662013 | 3300032805 | Soil | FCEEQLGFGTAKAVIASRAATVHASTLLAPSQEPMAGA |
| Ga0335081_126055331 | 3300032892 | Soil | EVPPGFGTAKAVIAPRAVTVHVSTLLTLSQESVARA |
| Ga0335072_107457291 | 3300032898 | Soil | FCEEQLGFGSAKAVIASRAATVHASTLLTPSQELMAGA |
| Ga0335073_103368681 | 3300033134 | Soil | ATRPEKTDWFCEEQLGFGTAKAVIASRAATVHASTLLAPSQEPMAGA |
| Ga0335073_105533944 | 3300033134 | Soil | TDWFCEEQLGFGSAKAVIASRAATVHASTLLTPSQELMAGA |
| Ga0335073_106614781 | 3300033134 | Soil | KTDWFCEEQLGFGTAKAVIASRAATVHASTLLAPSQELMAGA |
| Ga0335073_117012402 | 3300033134 | Soil | TDWFCEEQLGFGSAKAVIASRAATVHASTLVTPSQELLAGA |
| Ga0314786_147423_440_547 | 3300034664 | Soil | GELGFGTAKAAITSRVAVVHVARLSALSQEVATGA |
| ⦗Top⦘ |