Scaffold sp300_12631222

Overview

Basic Information

• Taxon OID: 2124908012
• Scaffold ID: sp300_12631222
• Source Dataset Name: Human Subgingival plaque microbiome from visit number 1 of subject 763496533
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Los Alamos National Laboratory
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3163
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (62.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Oral Cavity → Unclassified → Subgingival Plaque → Subgingival Plaque Microbial Communities From Los Alamos National Laboratory, Usa

Source Dataset Sampling Location

• Location Name: St. Louis, MO, USA
• Coordinates
  • Lat. (^o): 38.646
  • Long. (^o): -90.224

Associated Families

Family	Category	Number of Sequences	3D Structure?
F073671	Metagenome	120	N

Sequences

Protein ID	Family	RBS	Sequence
sp300_01223590	F073671	GAGG	MSSNQAEHELAELHEKERSLEKALELVREKIRELINYTNKNKAAR