Scaffold CNA_F6ESG4R02HBH5Q

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold CNA_F6ESG4R02HBH5Q

Scaffold CNA_F6ESG4R02HBH5Q

Overview

Basic Information
Taxon OID	2088090002 Open in IMG/M
Scaffold ID	CNA_F6ESG4R02HBH5Q Open in IMG/M
Source Dataset Name	Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Beijing Genomics Institute (BGI), Lifesequencing S.L.
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	507
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere → Quercus Rhizosphere Microbial Communities From Sierra Nevada National Park, Granada, Spain

Source Dataset Sampling Location
Location Name	Sierra Nevada National Park, Granada, Spain
Coordinates	Lat. (^o)	36.96213	Long. (^o)	-3.41928	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067652	Metagenome / Metatranscriptome	125	Y

Sequences

Protein ID	Family	RBS	Sequence
CNA_00726310	F067652	AGAAGG	MNVGDPNRADGDHLLLRESDMPVVVKIPGKVKTGGAKGHYCKSNFS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.