| Basic Information | |
|---|---|
| Taxon OID | 2081372005 Open in IMG/M |
| Scaffold ID | SRM_contig48605 Open in IMG/M |
| Source Dataset Name | Rangifer tarandus platyrhynchus rumen microbial communities from Svalbard, Norway - Sample 549 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Macrogen |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 571 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rangifer Tarandus Platyrhynchus Rumen → Rangifer Tarandus Platyrhynchus Rumen Microbial Communities From Svalbard, Norway |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Longyearbyen, Svalbard | |||||||
| Coordinates | Lat. (o) | 78.2166667 | Long. (o) | 15.6333333 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F093041 | Metagenome / Metatranscriptome | 106 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| SRM_00400330 | F093041 | GGAGG | MIIDGEKPKSFSPRALLRSKTARLFCHILIAMSIGRMIQRIIRCQTCRLAAKSIESSIDFAIR |
| ⦗Top⦘ |