NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 2081372005

2081372005: Rangifer tarandus platyrhynchus rumen microbial communities from Svalbard, Norway - Sample 549



Overview

Basic Information
IMG/M Taxon OID2081372005 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0046228 | Gp0051877 | Ga0010750
Sample NameRangifer tarandus platyrhynchus rumen microbial communities from Svalbard, Norway - Sample 549
Sequencing StatusPermanent Draft
Sequencing CenterMacrogen
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size26328181
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria1
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameRangifer Tarandus Platyrhynchus Rumen Microbial Communities From Svalbard, Norway
TypeHost-Associated
TaxonomyHost-Associated → Mammals → Digestive System → Foregut → Rumen → Rangifer Tarandus Platyrhynchus Rumen → Rangifer Tarandus Platyrhynchus Rumen Microbial Communities From Svalbard, Norway

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal proximal gut

Location Information
LocationLongyearbyen, Svalbard
CoordinatesLat. (o)78.2166667Long. (o)15.6333333Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F041506Metagenome / Metatranscriptome160Y
F077958Metagenome / Metatranscriptome117N
F093041Metagenome / Metatranscriptome106Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
SRM_contig25140All Organisms → cellular organisms → Bacteria652Open in IMG/M
SRM_contig31614Not Available508Open in IMG/M
SRM_contig48605Not Available571Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
SRM_contig25140SRM_00378750F041506MGKTYTLEDGESLLAELKSTRGKMAEMKGRLERDEITPDEWRQWYAGYKARLDEIREAVSGMREEVSRRNADLERQKRERAAELDMSFEEYEDYLKALIIS
SRM_contig31614SRM_00066250F077958MNRSSRLMALGGLSALTLLIGCLDSIVRELGPENDPQVTNTAASFEFKAEDMENVNDELTFNWVNSAPQAAFRHNSFIHHGYGIVIITDGAGVQVDSTLLELDLDAETKVGTPGNWTETG
SRM_contig48605SRM_00400330F093041MIIDGEKPKSFSPRALLRSKTARLFCHILIAMSIGRMIQRIIRCQTCRLAAKSIESSIDFAIR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.