Scaffold MiccSRB_contig14173

Overview

Basic Information

• Taxon OID: 2070309003
• Scaffold ID: MiccSRB_contig14173
• Source Dataset Name: Concrete drainage pipe biofilm microbial communities from Ohio, US - sample 12383, Newbler assembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: 454 Life Sciences
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1354
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Storm Water → Drainage Pipe Biofilm → Concrete Drainage Pipe Biofilm → Concrete Drainage Pipe Biofilm Microbial Communities From Ohio, Us

Source Dataset Sampling Location

• Location Name: Ohio, USA
• Coordinates
  • Lat. (^o): 39.8
  • Long. (^o): -84.3

Associated Families

Family	Category	Number of Sequences	3D Structure?
F084812	Metagenome / Metatranscriptome	112	Y

Sequences

Protein ID	Family	RBS	Sequence
MiccSRB_01066930	F084812	N/A	MSKQSILKLDNWGKGLLISIISKAISSDKDITQDDIEKLKEIKKQLQEIQPPDKK