Scaffold mobDRAFT_NODE_731_len_4875_cov_15_924513

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold mobDRAFT_NODE_731_len_4875_cov_15_924513

Scaffold mobDRAFT_NODE_731_len_4875_cov_15_924513

Overview

Basic Information
Taxon OID	2044078009 Open in IMG/M
Scaffold ID	mobDRAFT_NODE_731_len_4875_cov_15_924513 Open in IMG/M
Source Dataset Name	Sample 10347
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	J. Craig Venter Institute (JCVI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	4909
Total Scaffold Genes	7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (71.43%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Haemophilus → Haemophilus parainfluenzae	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Unclassified → Human Oral → Human Oral Microbial Communities From J. Craig Venter Institute, Usa

Source Dataset Sampling Location
Location Name
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077405	Metagenome	117	N

Sequences

Protein ID	Family	RBS	Sequence
mobDRAFT_116260	F077405	N/A	QGRALPTELFPRLLVAKQRGVFYGFILLCQIKFVKKFFDWLKIIQKQKVRLK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.