Scaffold PLMO_FPCF17101_b1

Overview

Basic Information

• Taxon OID: 2013843001
• Scaffold ID: PLMO_FPCF17101_b1
• Source Dataset Name: Activated sludge microbial communities from Commune de Morges, Switzerland - plasmid pool Morges-2007 (PGA)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 836
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Aerobic) → Activated Sludge → Wastewater Plasmid Pools → Activated Sludge Microbial Communities From Commune De Morges, Switzerland

Source Dataset Sampling Location

• Location Name: Bief, Commune de Morges, Canton Vaud, Switzerland
• Coordinates
  • Lat. (^o): 46.51668
  • Long. (^o): 6.510145
  • Depth (m): .3

Associated Families

Family	Category	Number of Sequences	3D Structure?
F069722	Metagenome / Metatranscriptome	123	Y

Sequences

Protein ID	Family	RBS	Sequence
PLMO_259200	F069722	N/A	ARRMRVRLTAELDPKAKRKRPDLDKGAAHEKALGQGSGAALQE