| Basic Information | |
|---|---|
| Family ID | F104839 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MQPLTLNAADVSTWVSRMWWPVLRVGGFVLAAPIASEGVVPG |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 54.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 93.00 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (87.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.43% β-sheet: 0.00% Coil/Unstructured: 58.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF01313 | Bac_export_3 | 61.00 |
| PF00813 | FliP | 28.00 |
| PF01052 | FliMN_C | 4.00 |
| PF04347 | FliO | 3.00 |
| PF05649 | Peptidase_M13_N | 1.00 |
| PF00854 | PTR2 | 1.00 |
| PF02154 | FliM | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG3190 | Flagellar biogenesis protein FliO | Cell motility [N] | 3.00 |
| COG1868 | Flagellar motor switch protein FliM | Cell motility [N] | 1.00 |
| COG3104 | Dipeptide/tripeptide permease | Amino acid transport and metabolism [E] | 1.00 |
| COG3590 | Predicted metalloendopeptidase | Posttranslational modification, protein turnover, chaperones [O] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 87.00 % |
| Unclassified | root | N/A | 13.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000546|LJNas_1034412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 547 | Open in IMG/M |
| 3300000903|JGI11872J12872_101773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 684 | Open in IMG/M |
| 3300001170|JGI12704J13340_1014441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae | 627 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101323988 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 612 | Open in IMG/M |
| 3300004092|Ga0062389_104125390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 546 | Open in IMG/M |
| 3300004635|Ga0062388_102304160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 562 | Open in IMG/M |
| 3300006052|Ga0075029_100449022 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 845 | Open in IMG/M |
| 3300006796|Ga0066665_10830215 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 725 | Open in IMG/M |
| 3300009143|Ga0099792_10621721 | Not Available | 691 | Open in IMG/M |
| 3300009665|Ga0116135_1450197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 528 | Open in IMG/M |
| 3300009709|Ga0116227_11481543 | Not Available | 509 | Open in IMG/M |
| 3300009709|Ga0116227_11486318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium | 508 | Open in IMG/M |
| 3300009762|Ga0116130_1252086 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 561 | Open in IMG/M |
| 3300010159|Ga0099796_10220010 | Not Available | 778 | Open in IMG/M |
| 3300010159|Ga0099796_10436856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 580 | Open in IMG/M |
| 3300010343|Ga0074044_10632476 | Not Available | 698 | Open in IMG/M |
| 3300010876|Ga0126361_10896073 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 576 | Open in IMG/M |
| 3300012189|Ga0137388_11323238 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 660 | Open in IMG/M |
| 3300012202|Ga0137363_11764081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 512 | Open in IMG/M |
| 3300012361|Ga0137360_10607193 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 937 | Open in IMG/M |
| 3300012685|Ga0137397_10391445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1035 | Open in IMG/M |
| 3300012927|Ga0137416_11196746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 684 | Open in IMG/M |
| 3300014158|Ga0181521_10080441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2073 | Open in IMG/M |
| 3300014167|Ga0181528_10084232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1736 | Open in IMG/M |
| 3300014169|Ga0181531_11071809 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 507 | Open in IMG/M |
| 3300014201|Ga0181537_10392336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae | 952 | Open in IMG/M |
| 3300014201|Ga0181537_10589541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 758 | Open in IMG/M |
| 3300014499|Ga0182012_10577229 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 725 | Open in IMG/M |
| 3300014501|Ga0182024_10346546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1943 | Open in IMG/M |
| 3300015167|Ga0167661_1013975 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1444 | Open in IMG/M |
| 3300015193|Ga0167668_1096060 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 553 | Open in IMG/M |
| 3300018034|Ga0187863_10657087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 591 | Open in IMG/M |
| 3300019787|Ga0182031_1030879 | Not Available | 1426 | Open in IMG/M |
| 3300019787|Ga0182031_1214376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1122 | Open in IMG/M |
| 3300019890|Ga0193728_1078401 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1559 | Open in IMG/M |
| 3300020062|Ga0193724_1035650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1058 | Open in IMG/M |
| 3300020580|Ga0210403_10283551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1358 | Open in IMG/M |
| 3300020580|Ga0210403_11219582 | Not Available | 579 | Open in IMG/M |
| 3300020582|Ga0210395_11169183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae | 566 | Open in IMG/M |
| 3300020583|Ga0210401_11500617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 531 | Open in IMG/M |
| 3300021168|Ga0210406_10343714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1205 | Open in IMG/M |
| 3300021180|Ga0210396_10150797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2088 | Open in IMG/M |
| 3300021181|Ga0210388_10562790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 998 | Open in IMG/M |
| 3300021401|Ga0210393_11466626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 544 | Open in IMG/M |
| 3300021402|Ga0210385_10545669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 881 | Open in IMG/M |
| 3300021402|Ga0210385_11198407 | Not Available | 583 | Open in IMG/M |
| 3300021405|Ga0210387_11564119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 562 | Open in IMG/M |
| 3300021407|Ga0210383_10747770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 839 | Open in IMG/M |
| 3300021407|Ga0210383_11486430 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 561 | Open in IMG/M |
| 3300021407|Ga0210383_11741914 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 509 | Open in IMG/M |
| 3300021433|Ga0210391_10358858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1143 | Open in IMG/M |
| 3300021433|Ga0210391_11084034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 622 | Open in IMG/M |
| 3300021474|Ga0210390_11409516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 555 | Open in IMG/M |
| 3300021475|Ga0210392_10382133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1024 | Open in IMG/M |
| 3300021475|Ga0210392_10969633 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 636 | Open in IMG/M |
| 3300021479|Ga0210410_11624332 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 540 | Open in IMG/M |
| 3300021559|Ga0210409_11286667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 607 | Open in IMG/M |
| 3300024288|Ga0179589_10158173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 971 | Open in IMG/M |
| 3300025359|Ga0208322_1021143 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 618 | Open in IMG/M |
| 3300025633|Ga0208480_1127663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 588 | Open in IMG/M |
| 3300026291|Ga0209890_10038154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1810 | Open in IMG/M |
| 3300027089|Ga0207943_106867 | Not Available | 724 | Open in IMG/M |
| 3300027174|Ga0207948_1039744 | Not Available | 567 | Open in IMG/M |
| 3300027562|Ga0209735_1134149 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 539 | Open in IMG/M |
| 3300027583|Ga0209527_1135722 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 547 | Open in IMG/M |
| 3300027629|Ga0209422_1160989 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 501 | Open in IMG/M |
| 3300027660|Ga0209736_1039381 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1376 | Open in IMG/M |
| 3300027701|Ga0209447_10149110 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 642 | Open in IMG/M |
| 3300027860|Ga0209611_10165247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1386 | Open in IMG/M |
| 3300027898|Ga0209067_10519751 | Not Available | 677 | Open in IMG/M |
| 3300027908|Ga0209006_10019183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae | 6205 | Open in IMG/M |
| 3300028017|Ga0265356_1031867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 574 | Open in IMG/M |
| 3300028773|Ga0302234_10065842 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1618 | Open in IMG/M |
| 3300028789|Ga0302232_10144325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1202 | Open in IMG/M |
| 3300028801|Ga0302226_10476390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae | 521 | Open in IMG/M |
| 3300029951|Ga0311371_10398774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1873 | Open in IMG/M |
| 3300029994|Ga0302283_1027913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2926 | Open in IMG/M |
| 3300030056|Ga0302181_10153697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1096 | Open in IMG/M |
| 3300030580|Ga0311355_10529102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1125 | Open in IMG/M |
| 3300030617|Ga0311356_11710657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 563 | Open in IMG/M |
| 3300030618|Ga0311354_11008047 | Not Available | 767 | Open in IMG/M |
| 3300030646|Ga0302316_10298192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 652 | Open in IMG/M |
| 3300030688|Ga0311345_10264138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1666 | Open in IMG/M |
| 3300030693|Ga0302313_10273192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae | 675 | Open in IMG/M |
| 3300030763|Ga0265763_1042041 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 554 | Open in IMG/M |
| 3300030815|Ga0265746_1022936 | Not Available | 769 | Open in IMG/M |
| 3300030815|Ga0265746_1043724 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 607 | Open in IMG/M |
| 3300031231|Ga0170824_121106402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 727 | Open in IMG/M |
| 3300031231|Ga0170824_123285194 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 901 | Open in IMG/M |
| 3300031234|Ga0302325_10102583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae | 5351 | Open in IMG/M |
| 3300031525|Ga0302326_11282783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae | 1000 | Open in IMG/M |
| 3300031616|Ga0307508_10657493 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 654 | Open in IMG/M |
| 3300031708|Ga0310686_103239784 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 518 | Open in IMG/M |
| 3300031708|Ga0310686_108278948 | Not Available | 1264 | Open in IMG/M |
| 3300031718|Ga0307474_10061932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2770 | Open in IMG/M |
| 3300031753|Ga0307477_11127131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 511 | Open in IMG/M |
| 3300031788|Ga0302319_11202253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 700 | Open in IMG/M |
| 3300032515|Ga0348332_11380594 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 721 | Open in IMG/M |
| 3300032898|Ga0335072_10107925 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 3535 | Open in IMG/M |
| 3300034163|Ga0370515_0287127 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 696 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.00% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 12.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 10.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.00% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 5.00% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.00% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 3.00% |
| Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 3.00% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.00% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 2.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.00% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.00% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.00% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.00% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.00% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.00% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.00% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.00% |
| Quercus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere | 1.00% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 1.00% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.00% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Host-Associated | Open in IMG/M |
| 3300000903 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O1 | Environmental | Open in IMG/M |
| 3300001170 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009709 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MG | Host-Associated | Open in IMG/M |
| 3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014499 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015167 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11b, vegetated hydrological feature) | Environmental | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025359 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025633 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
| 3300027089 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027174 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF040 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027860 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Host-Associated | Open in IMG/M |
| 3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029994 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_4 | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030646 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030688 | II_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300030693 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030815 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Host-Associated | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| LJNas_10344121 | 3300000546 | Quercus Rhizosphere | MQPLTLNAADVSMWVSRMWWPALRISGFVLAAPIASEAV |
| JGI11872J12872_1017731 | 3300000903 | Forest Soil | MQPLTLNAADVSTWVSRMWWPVLRVGGFVLAAPIASEGVVPG |
| JGI12704J13340_10144411 | 3300001170 | Forest Soil | MQPVTLNAADVSLWVSRLWWPTLRVGGFFLSAPIASENTIPSFI |
| JGIcombinedJ26739_1013239881 | 3300002245 | Forest Soil | MSVMQPLVVSTADVSQMVARLWWPSLRIGGFILAAPIASESTIPSRVKIVL |
| Ga0062389_1041253901 | 3300004092 | Bog Forest Soil | MPIMHPVAIDAADVTKWVARLWWPVLRIGGFVATAPIASEKTVPTPVKIALTLG |
| Ga0062388_1023041602 | 3300004635 | Bog Forest Soil | MQPVLIDAADVSKWVTRLWWPVLRIGGFVLTAPIASETTVPNLVKIALTLGL |
| Ga0075029_1004490223 | 3300006052 | Watersheds | MALQPIPIDADAISAWVAGLWWPVLRVGGFVATAPI |
| Ga0066665_108302153 | 3300006796 | Soil | MAVMQPLVVSAADVSQMVARLWWPSLRIGGFVLAAPIASESTIPRRVKIVL |
| Ga0099792_106217211 | 3300009143 | Vadose Zone Soil | MTAMQPLVISAADVSQMVARLWWPSLRIGGVVLAAPLAGESTIPP |
| Ga0116135_14501971 | 3300009665 | Peatland | MATIQPLMLDAADVSRWVARLWWPVLRIGGFVLTAP |
| Ga0116227_114815431 | 3300009709 | Host-Associated | MQPITLNAADVTTWVSRVWWPALRVSGFVMSAPVASEVSVPS |
| Ga0116227_114863181 | 3300009709 | Host-Associated | MATLQPIMIDAADVSRWVARLWWPVLRIGGFVLTAPI |
| Ga0116130_12520861 | 3300009762 | Peatland | MQPVFINAADVSGLVGRLWWPSLRIGGFVLAAPIASEVAIPSRVKI |
| Ga0099796_102200103 | 3300010159 | Vadose Zone Soil | MTAMQPLVISAADVSQMVARLWWPSLRIGGFVLAAPIASESTIP |
| Ga0099796_104368561 | 3300010159 | Vadose Zone Soil | MQPLTLNAADVSMWVSRMWWPMLRVGGFVLAAPIASET |
| Ga0074044_106324763 | 3300010343 | Bog Forest Soil | MQPLTLNASDVSMWVGRMWWPVLRISGFVLTAPATSEAVVPRLVKI |
| Ga0126361_108960733 | 3300010876 | Boreal Forest Soil | MQAVTLNAADVTQWVGRLWWPALRVGGFVLAAPTVSEGVIPARIKI |
| Ga0137388_113232381 | 3300012189 | Vadose Zone Soil | MQPLTLNAADVSLWVGRLWWPMLRVGGFFLAAPIASEA |
| Ga0137363_117640811 | 3300012202 | Vadose Zone Soil | MTAMQPLVVSAADVSQMVARLWWPSLRIGGFVLAAPIAS |
| Ga0137360_106071933 | 3300012361 | Vadose Zone Soil | VQPLTLNAADVSLWVGRMWWPMLRVGGFVLAAPIASETVIPGRV |
| Ga0137397_103914451 | 3300012685 | Vadose Zone Soil | MQPLTLNAADVSMWVGRMWWPVLRIGGFVLAAPIASEGVVPRLV |
| Ga0137416_111967461 | 3300012927 | Vadose Zone Soil | MTAMQPLVVSAADVSQMVARLWWPSLRIGGFVLAAPIA |
| Ga0181521_100804416 | 3300014158 | Bog | MQPILIDAADISRWVARLWWPVLRIGGFVLTAPIASER |
| Ga0181528_100842321 | 3300014167 | Bog | MATIQPIMIDAADVSRWVARLWWPVLRIGGFVLTAPIASESSIPPP |
| Ga0181531_110718093 | 3300014169 | Bog | MQSLVINATDVSGLMGRLWWPSLRIGGFVLAAPIASEVTIPGRVK |
| Ga0181537_103923363 | 3300014201 | Bog | MQPVLLDVSDISQWVARLWWPVLRVGGFVASAPIASEGTIPGPVKIALSLGLAF |
| Ga0181537_105895413 | 3300014201 | Bog | VQTITLNAADVSSWVSRLWWPALRVGGFVLTAPAASETSVPSLVKIVLTLGLA |
| Ga0182012_105772293 | 3300014499 | Bog | MQPVVINAVDVSHWIGKMWWPSLRIGGFVATAPIASE |
| Ga0182024_103465461 | 3300014501 | Permafrost | MQPVTLNAADVSLWVNRLWWPMLRIGGFVLAAPIA |
| Ga0167661_10139754 | 3300015167 | Glacier Forefield Soil | MQPLTINAADVSHWVSRLWWPVLRVGGFVLAAPVASETVI |
| Ga0167668_10960603 | 3300015193 | Glacier Forefield Soil | MQPVTLNAADVSMWVSRLWWPALRVGGFVLAAPIASETVIPRRSK |
| Ga0187863_106570873 | 3300018034 | Peatland | MQPVTLNAADVSMWVSRLWWPTLRVGGFVLAAPVA |
| Ga0182031_10308791 | 3300019787 | Bog | VQPLTLNAADVSTWVGRVWWPMLRVGGFVLAAPIASETGERDRHP |
| Ga0182031_12143763 | 3300019787 | Bog | MATIQPILIDAADVSRWVARLWWPVLRIGGFVLTAPVASESAIP |
| Ga0193728_10784011 | 3300019890 | Soil | VQPLTLNASDVSLWVGRLWWPMLRVGGFVLAAPIASETVIPRLVK |
| Ga0193724_10356501 | 3300020062 | Soil | MTAMQPLVVSAADVSQMVARLWWPSLRIGGFVLAAPIASESTIPRRVKIVL |
| Ga0210403_102835514 | 3300020580 | Soil | MTTMQPFVVSAADVSQMVARLWWPSLRIGGFVLAAPIASEST |
| Ga0210403_112195823 | 3300020580 | Soil | MQPVILNAADVTQWVGRMWWPVLRVGGFVLAAPTVSEGVI |
| Ga0210395_111691833 | 3300020582 | Soil | MQPFLIDAADISKWVVRLWWPILRIGGFILSAPITSAATVPS |
| Ga0210401_115006173 | 3300020583 | Soil | MQPVTLNAGDVSMWVSRMWWPSLRVGGFVLAAPIASEA |
| Ga0210406_103437143 | 3300021168 | Soil | MLPVLIDASDLSKWVIRLWWPVLRIGGFVLTAPLLSG |
| Ga0210396_101507971 | 3300021180 | Soil | MQPLTLNVSDVSMWVGRMWWPVLRISGFVLTAPAT |
| Ga0210388_105627903 | 3300021181 | Soil | MQPVLVNVSDISQWVARLWWPVLRVGGFVASAPVASEATIPGPVKIALSL |
| Ga0210393_114666263 | 3300021401 | Soil | MQPVTLNAADVSLWVSRLWWPTLRVGGFVLSAPVASETTIPS |
| Ga0210385_105456693 | 3300021402 | Soil | MQPVLVNVSDISQWVARLWWPVLRVGGFVASAPVASEATIPGPVK |
| Ga0210385_111984071 | 3300021402 | Soil | MQPLTLNAADVQTWVGRLWWPALRVGGFVLTAPIASEASVPR |
| Ga0210387_115641191 | 3300021405 | Soil | MQPLTLNAADVSMWVSRMWWPALRIGGFVLAAPIA |
| Ga0210383_107477701 | 3300021407 | Soil | MQPLALNAADVSMWVSRMWWPALRVSGFVLTAPAASDTVVPGRV |
| Ga0210383_114864303 | 3300021407 | Soil | MQPLTLNASDVSMWVGRMWWPVLRISGFVLTAPTTS |
| Ga0210383_117419141 | 3300021407 | Soil | MQPLTLNASDVSMWVGRMWWPVLRIGGFVLTAPAASEAAVPRLVKIVLT |
| Ga0210391_103588583 | 3300021433 | Soil | MQPVLVNVADISQWVARLWWPVLRVGGFVASAPVASE |
| Ga0210391_110840341 | 3300021433 | Soil | MQPVLVNVADISQWVARLWWPVLRVGGFVASAPVASEATIPGPVKIALSI |
| Ga0210390_114095161 | 3300021474 | Soil | MQPLTPNAADVSMWVSRMWWPVLRIGGFVLAAPLAGEGVVPGLVKIV |
| Ga0210392_103821333 | 3300021475 | Soil | VQPVILNAADVSTWVGRLWWPTLRVAGFVLAAPIASEAVIPRLVKIVMSVAL |
| Ga0210392_109696331 | 3300021475 | Soil | VQPVTLNAADVSMWVGRLWWPMLRVGGFVLAAPIA |
| Ga0210410_116243321 | 3300021479 | Soil | VQPLTLNAADVSQWVGRMWWPMLRVGGFVLAAPIASETVIPGRIKIV |
| Ga0210409_112866673 | 3300021559 | Soil | MQPLTLNASDVSMWVSRMWWPVLRISGFVLAAPITGEGVVPGLVKIVLTLAL |
| Ga0179589_101581731 | 3300024288 | Vadose Zone Soil | MTAMQPLVISAADVSQMVARLWWPSLRIGGFVLAAPIASEST |
| Ga0208322_10211431 | 3300025359 | Peatland | MAQPITFSAADVSIWVGRLWWPSLRIGGFIMAAPV |
| Ga0208480_11276633 | 3300025633 | Arctic Peat Soil | MQPLTLNVSDVSMWVSRMWWPALRVSGFVLAAPITSEAVVPSLVKI |
| Ga0209890_100381545 | 3300026291 | Soil | MQPLTLNTADVSMWVSRMWWPALRVTGFVLTAPAASETVVPRLVKVVLTLAL |
| Ga0207943_1068671 | 3300027089 | Forest Soil | MQPVLVNVADISQWVARLWWPVLRVGGFVASAPVASEATIPGPVKI |
| Ga0207948_10397441 | 3300027174 | Forest Soil | MQPLTLNASDVSMWVGRMWWPVLRISGFVLTAPTSSE |
| Ga0209735_11341491 | 3300027562 | Forest Soil | MQPLTLNAADVSMWVSRMWWPVLRISGFVLTAPAASEM |
| Ga0209527_11357221 | 3300027583 | Forest Soil | MQPLTLNAADVSMWVSRMWWPVLRISGFVLTAPAASEMVV |
| Ga0209422_11609893 | 3300027629 | Forest Soil | MQPLTLNASDVSMWVGRMWWPVLRIGGFVLTAPAASEAAVPRLVKIVL |
| Ga0209736_10393814 | 3300027660 | Forest Soil | MTVMQPLVVSAADVSQMVARLWWPSLRIGGFVLAAPIA |
| Ga0209447_101491103 | 3300027701 | Bog Forest Soil | MQPVALNAADVTQWVDRLWWPVLRVGGFVLAAPTVSEGVIPA |
| Ga0209611_101652474 | 3300027860 | Host-Associated | MQPLTLSAADVQMWVGRLWWPALRVGGFVLTAPIASEAT |
| Ga0209067_105197513 | 3300027898 | Watersheds | MQPLTLNASDVSMWVGRMWWPVLRISGFVLTAPAASEAVVPRLVRIVLTLA |
| Ga0209006_100191831 | 3300027908 | Forest Soil | MSVMQPLVVSTADVSQMVARLWWPSLRIGGFILAAPIASES |
| Ga0265356_10318671 | 3300028017 | Rhizosphere | MQPLALNAADVSMWVGRMWWPALRVSGFVLTAPAVSETVVPGRVKIVLTL |
| Ga0302234_100658425 | 3300028773 | Palsa | MQPLTLNAADVSMWVSRMWWPTLRIGGFLLAAPVASEAVVPG |
| Ga0302232_101443251 | 3300028789 | Palsa | MQPVLINAADLSTWVARSWWPVLRIGGFVLSAPIAS |
| Ga0302226_104763903 | 3300028801 | Palsa | MQPVTLNVSDISQWVARLWWPVLRVGGFVASAPVASE |
| Ga0311371_103987741 | 3300029951 | Palsa | MQPVLVNVSDISQWVARLWWPVLRVGGFVASAPVASEATIPGP |
| Ga0302283_10279131 | 3300029994 | Fen | MSPQPLTLDVALVADWVQRLWWPVLRISGFVLAAPLYSQGVVPRLVKIALTLG |
| Ga0302181_101536971 | 3300030056 | Palsa | MQPVLLNVSDISQWVARLWWPVLRVGGFVVSAPIASETTIPG |
| Ga0311355_105291021 | 3300030580 | Palsa | MQPVTLNAADVSLWVSRLWWPTLRVGGFMLSAPVASETTIPSFIKIILSVS |
| Ga0311356_117106573 | 3300030617 | Palsa | MAQPITFSAVDVSIWVGRVWWPSLRIGGFIMAAPVASEMTIPSRVKLIF |
| Ga0311354_110080473 | 3300030618 | Palsa | MQPLTLNAADVTTWVGRMWWPVLRVSGFVLAAPATGEAVVPGLVKIV |
| Ga0302316_102981921 | 3300030646 | Palsa | MQPVLLNVSDISQWVARLWWPVLRVGGFVVSAPIASETTI |
| Ga0311345_102641385 | 3300030688 | Bog | MATVQPLLIDAADISKWVARLWWPVLRIGGFVLTAPIASESAIP |
| Ga0302313_102731923 | 3300030693 | Palsa | MQPVLLNVSDISQWVARLWWPVLRVGGFVVSAPIA |
| Ga0265763_10420411 | 3300030763 | Soil | MQPVTLNAADVTQWVGRMWWPILRVGGFVLAAPTVSEGVIPPRIK |
| Ga0265746_10229361 | 3300030815 | Soil | MQPLTLNVSDVSTWVSRMWWPALRIGGFMLAAPVASETVVP |
| Ga0265746_10437243 | 3300030815 | Soil | VQPVVLNVADVSTMVARLWWPTLRVGGFVLAAPIA |
| Ga0170824_1211064023 | 3300031231 | Forest Soil | MQPVIINAADVSQWVGRLWWPALRVGGFVLAAPIASETVIPRLVKIILSVSL |
| Ga0170824_1232851941 | 3300031231 | Forest Soil | MQPLTLNAADVSMWVSRMWWPALRVGGFVLAAPIASEG |
| Ga0302325_101025831 | 3300031234 | Palsa | MQPLTLNAADVTTWVGRMWWPVLRVSGFVLAAPATGEAVVP |
| Ga0302326_112827833 | 3300031525 | Palsa | VQPLTLNAADVSTWVGRLWWPTLRVGGFVLAAPIASESVIPNLVKIIL |
| Ga0307508_106574931 | 3300031616 | Ectomycorrhiza | MQPLTLNAADVSMWVSRMWWPALRVAGFVLAAPISSEGVV |
| Ga0310686_1032397843 | 3300031708 | Soil | MQPITLNAADVTTWVSRLWWPALRVSGFVMTAPTVSEISVPSLVKIVLTLAL |
| Ga0310686_1082789484 | 3300031708 | Soil | MQPVLIDAANLSTWVTRLWWPVLRIGGFVLTAPIASEATVP |
| Ga0307474_100619326 | 3300031718 | Hardwood Forest Soil | MQPVILNAADVTQWVGRMWWPVLRVGGFVLAAPTVSEGVIPPRIKI |
| Ga0307477_111271313 | 3300031753 | Hardwood Forest Soil | MQPLTLNAADVSTWVGRMWWPVLRIAGFILAAPITGEGVVPGLVKV |
| Ga0302319_112022531 | 3300031788 | Bog | MATVQPLLIDAADISKWVARLWWPVLRIGGFVLTAPIASE |
| Ga0348332_113805941 | 3300032515 | Plant Litter | MQPLTLNAADVSMWVSRMWWPSLRIGGFILAAPVASEAVVPTLVKIV |
| Ga0335072_101079251 | 3300032898 | Soil | MQPVLVNASDISRWASHLWWPALRIGGFVLTAPIASEASIPSPVKIALSL |
| Ga0370515_0287127_3_143 | 3300034163 | Untreated Peat Soil | MQPVLINAADVSGLVGRLWWPSLRIAGFVLAAPIASEVVIPGRVKIV |
| ⦗Top⦘ |