| Basic Information | |
|---|---|
| Family ID | F104576 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 46 residues |
| Representative Sequence | YDSDNNYETTEILIDSITTDEGLLAPYAVGEINLQVRYQIM |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.00 % |
| % of genes from short scaffolds (< 2000 bps) | 89.00 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.25 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (74.000 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater (16.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (58.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 8.70% Coil/Unstructured: 91.30% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.25 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF05065 | Phage_capsid | 1.00 |
| PF06805 | Lambda_tail_I | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 1.00 |
| COG4723 | Phage-related protein, tail assembly protein I | Mobilome: prophages, transposons [X] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 89.00 % |
| Unclassified | root | N/A | 11.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002206|metazooDRAFT_1288104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Demerecviridae → Markadamsvirinae → Tequintavirus | 512 | Open in IMG/M |
| 3300003493|JGI25923J51411_1032376 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1002 | Open in IMG/M |
| 3300003616|JGI25928J51866_1070950 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 785 | Open in IMG/M |
| 3300004240|Ga0007787_10112995 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1278 | Open in IMG/M |
| 3300004793|Ga0007760_11268104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2218 | Open in IMG/M |
| 3300005581|Ga0049081_10181104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 762 | Open in IMG/M |
| 3300005585|Ga0049084_10214027 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 655 | Open in IMG/M |
| 3300005805|Ga0079957_1005183 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10659 | Open in IMG/M |
| 3300006917|Ga0075472_10280707 | Not Available | 821 | Open in IMG/M |
| 3300007282|Ga0104350_1088709 | Not Available | 520 | Open in IMG/M |
| 3300007555|Ga0102817_1058388 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 843 | Open in IMG/M |
| 3300007555|Ga0102817_1139715 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium ADurb.Bin216 | 540 | Open in IMG/M |
| 3300007559|Ga0102828_1051120 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 961 | Open in IMG/M |
| 3300007559|Ga0102828_1193833 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 519 | Open in IMG/M |
| 3300007562|Ga0102915_1117218 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 871 | Open in IMG/M |
| 3300007562|Ga0102915_1275201 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
| 3300007692|Ga0102823_1170272 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
| 3300007861|Ga0105736_1155428 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
| 3300007974|Ga0105747_1332541 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
| 3300008962|Ga0104242_1000333 | Not Available | 9885 | Open in IMG/M |
| 3300009026|Ga0102829_1173601 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium ADurb.Bin216 | 695 | Open in IMG/M |
| 3300009039|Ga0105152_10033392 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium ADurb.Bin216 | 2038 | Open in IMG/M |
| 3300009068|Ga0114973_10279851 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 893 | Open in IMG/M |
| 3300009086|Ga0102812_10569967 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 620 | Open in IMG/M |
| 3300009419|Ga0114982_1214301 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
| 3300010354|Ga0129333_10185369 | Not Available | 1897 | Open in IMG/M |
| 3300010354|Ga0129333_10855542 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 772 | Open in IMG/M |
| 3300010354|Ga0129333_11442173 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 565 | Open in IMG/M |
| 3300010885|Ga0133913_10056190 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10567 | Open in IMG/M |
| 3300011010|Ga0139557_1018455 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1293 | Open in IMG/M |
| 3300012000|Ga0119951_1150148 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
| 3300012012|Ga0153799_1042525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 848 | Open in IMG/M |
| 3300012665|Ga0157210_1029042 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 870 | Open in IMG/M |
| 3300012728|Ga0157552_1147507 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
| 3300012962|Ga0129335_1137173 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 1941 | Open in IMG/M |
| 3300012962|Ga0129335_1155640 | Not Available | 1782 | Open in IMG/M |
| 3300012968|Ga0129337_1282384 | Not Available | 778 | Open in IMG/M |
| 3300013006|Ga0164294_10451816 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 878 | Open in IMG/M |
| 3300013087|Ga0163212_1115478 | Not Available | 858 | Open in IMG/M |
| 3300013295|Ga0170791_11048884 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium ADurb.Bin216 | 579 | Open in IMG/M |
| 3300013295|Ga0170791_14313060 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 754 | Open in IMG/M |
| 3300013372|Ga0177922_10472198 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 855 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10541557 | Not Available | 646 | Open in IMG/M |
| 3300014960|Ga0134316_1028236 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 631 | Open in IMG/M |
| 3300020562|Ga0208597_1066863 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 640 | Open in IMG/M |
| 3300021141|Ga0214163_1125166 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 574 | Open in IMG/M |
| 3300021376|Ga0194130_10029130 | All Organisms → Viruses | 4351 | Open in IMG/M |
| 3300021961|Ga0222714_10222303 | Not Available | 1076 | Open in IMG/M |
| 3300021961|Ga0222714_10519124 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
| 3300021962|Ga0222713_10782766 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
| 3300022745|Ga0228698_1005988 | All Organisms → Viruses | 4190 | Open in IMG/M |
| 3300022752|Ga0214917_10113995 | Not Available | 1530 | Open in IMG/M |
| 3300024346|Ga0244775_10200905 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1672 | Open in IMG/M |
| 3300024346|Ga0244775_10221695 | All Organisms → Viruses → Predicted Viral | 1582 | Open in IMG/M |
| 3300024348|Ga0244776_10795778 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 572 | Open in IMG/M |
| 3300024482|Ga0255265_1106532 | Not Available | 536 | Open in IMG/M |
| 3300024500|Ga0255143_1052746 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 662 | Open in IMG/M |
| 3300024545|Ga0256347_1124453 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
| 3300024553|Ga0255301_1012654 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1520 | Open in IMG/M |
| 3300024555|Ga0255280_1038230 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 997 | Open in IMG/M |
| 3300024557|Ga0255283_1147986 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium ADurb.Bin216 | 501 | Open in IMG/M |
| 3300024565|Ga0255273_1013674 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1787 | Open in IMG/M |
| 3300024865|Ga0256340_1084462 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 782 | Open in IMG/M |
| 3300025032|Ga0210042_1198499 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 662 | Open in IMG/M |
| 3300025034|Ga0210041_1099935 | All Organisms → Viruses → Predicted Viral | 1210 | Open in IMG/M |
| 3300025756|Ga0255239_1008027 | All Organisms → Viruses → Predicted Viral | 1702 | Open in IMG/M |
| 3300025831|Ga0210015_1044281 | All Organisms → Viruses → Predicted Viral | 2218 | Open in IMG/M |
| 3300025896|Ga0208916_10286062 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 717 | Open in IMG/M |
| 3300026422|Ga0255308_1016780 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 888 | Open in IMG/M |
| 3300026569|Ga0255277_1137841 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 601 | Open in IMG/M |
| 3300026573|Ga0255269_1136459 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 660 | Open in IMG/M |
| 3300027146|Ga0255104_1025132 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1083 | Open in IMG/M |
| 3300027246|Ga0208931_1074580 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 622 | Open in IMG/M |
| 3300027314|Ga0208811_1109842 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 555 | Open in IMG/M |
| 3300027320|Ga0208923_1040326 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 832 | Open in IMG/M |
| 3300027418|Ga0208022_1080164 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 690 | Open in IMG/M |
| 3300027563|Ga0209552_1183084 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
| 3300027581|Ga0209651_1039509 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1433 | Open in IMG/M |
| 3300027600|Ga0255117_1055665 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 797 | Open in IMG/M |
| 3300027631|Ga0208133_1169490 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
| 3300027659|Ga0208975_1090182 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 899 | Open in IMG/M |
| 3300027710|Ga0209599_10015884 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2184 | Open in IMG/M |
| 3300027710|Ga0209599_10161498 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 598 | Open in IMG/M |
| 3300027724|Ga0209582_1292085 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium ADurb.Bin216 | 536 | Open in IMG/M |
| 3300027785|Ga0209246_10107444 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1094 | Open in IMG/M |
| 3300027785|Ga0209246_10223557 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 732 | Open in IMG/M |
| 3300027802|Ga0209476_10256950 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium ADurb.Bin216 | 775 | Open in IMG/M |
| 3300027808|Ga0209354_10203938 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 801 | Open in IMG/M |
| 3300027816|Ga0209990_10475735 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
| 3300027836|Ga0209230_10730201 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
| 3300027969|Ga0209191_1361009 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
| 3300028096|Ga0256362_1078367 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 515 | Open in IMG/M |
| 3300028100|Ga0256363_1004959 | All Organisms → Viruses | 2199 | Open in IMG/M |
| 3300028394|Ga0304730_1210603 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 728 | Open in IMG/M |
| 3300031999|Ga0315274_10038143 | All Organisms → Viruses | 6579 | Open in IMG/M |
| 3300032092|Ga0315905_10495065 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1127 | Open in IMG/M |
| 3300033978|Ga0334977_0167104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1128 | Open in IMG/M |
| 3300034019|Ga0334998_0740871 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
| 3300034072|Ga0310127_135657 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 995 | Open in IMG/M |
| 3300034093|Ga0335012_0368172 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 711 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 16.00% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 14.00% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 10.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.00% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.00% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.00% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.00% |
| Aquifer | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Aquifer | 3.00% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 3.00% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 3.00% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.00% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 3.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.00% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 2.00% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 2.00% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 1.00% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.00% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.00% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.00% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.00% |
| Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment | 1.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.00% |
| Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 1.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 1.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 1.00% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 1.00% |
| Aeration Tank Of Activated Sludge Process | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Aeration Tank Of Activated Sludge Process | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002206 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - OCT 2012 | Environmental | Open in IMG/M |
| 3300003493 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003616 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300004793 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007282 | Activated sludge microbial communities from bioreactor with dissolved oxygen in CSIR-NEERI, Nagpur, India ? 4ppm of oxygen, sample C | Engineered | Open in IMG/M |
| 3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007562 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02 | Environmental | Open in IMG/M |
| 3300007692 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743 | Environmental | Open in IMG/M |
| 3300007861 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372B_3um | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009039 | Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cm | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300012728 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES043 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012962 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012968 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300013087 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300014960 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0709 | Environmental | Open in IMG/M |
| 3300020562 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021141 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022745 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 1-17_Aug_MG | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300024482 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024500 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0h | Environmental | Open in IMG/M |
| 3300024545 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024553 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024555 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024557 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024565 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024865 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025032 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-18 (SPAdes) | Environmental | Open in IMG/M |
| 3300025034 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-03 (SPAdes) | Environmental | Open in IMG/M |
| 3300025756 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025831 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-22 (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026422 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026569 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026573 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027146 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_0h | Environmental | Open in IMG/M |
| 3300027246 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027314 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027320 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes) | Environmental | Open in IMG/M |
| 3300027418 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 (SPAdes) | Environmental | Open in IMG/M |
| 3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027600 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepA_8h | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027724 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB5-Kit (SPAdes) | Engineered | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027802 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_precipitate (SPAdes) | Engineered | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028096 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Atlam_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028100 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Atlam_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034072 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| metazooDRAFT_12881042 | 3300002206 | Lake | VYDSSGSETTEILITSITTDEWLLAPYAVGEINLQVRYALQ* |
| JGI25923J51411_10323761 | 3300003493 | Freshwater Lake | ANRVLVYDITNNLSTTEILIQSITTDEGLLNPYGVGEINLQVRYAL* |
| JGI25928J51866_10709502 | 3300003616 | Freshwater Lake | LDDLENVIDANRVLVYDITNNLSTTEILIQSITTDEGLLNPYGVGEINLQVRYAL* |
| Ga0007787_101129952 | 3300004240 | Freshwater Lake | IDNNRQLVYDSTTGYETTEILIASITTDEGLLAPYAVGEINLQVRYQIM* |
| Ga0007760_112681041 | 3300004793 | Freshwater Lake | LVYDATRNLSTTEILIQSITTDEGLLTPYGVGEINLQVRYALV* |
| Ga0049081_101811041 | 3300005581 | Freshwater Lentic | TNNLSTTEILIQSITTDEGLLAPYGVGELNLQVRYALV* |
| Ga0049084_102140272 | 3300005585 | Freshwater Lentic | DLENVIDANRVLVYDITNNLSTTEILIQSITTDEGLLNPYGVGEINLQVRYAL* |
| Ga0079957_10051838 | 3300005805 | Lake | YETTEILIDSITTDEGLLAPYAVGEINLQVRYQIM* |
| Ga0075472_102807073 | 3300006917 | Aqueous | LVYDAAAGHETTEILIDSITTDEGLLAPYAVGEINLQVRYQIM* |
| Ga0104350_10887092 | 3300007282 | Aeration Tank Of Activated Sludge Process | VLVDIEKCIDANRELAYDTGKETTEIDIVSIVTDEGLLKPFGVGEVTLQVRYQVL* |
| Ga0102817_10583881 | 3300007555 | Estuarine | LLRDLETCINNNRALVYDQANGLVTTEILIQSIMTDEGLLVPYGVGEINLQVRYALQ* |
| Ga0102817_11397151 | 3300007555 | Estuarine | VYDETNGYETTEILVTSITTDEGLLAPYAIGEINLQVRYQIM* |
| Ga0102828_10511202 | 3300007559 | Estuarine | TRNYETTEILVVSITTDEGLLAPYAVGEINLQVRYQIM* |
| Ga0102828_11938332 | 3300007559 | Estuarine | LQYDEINNYETTEILVVSITTDEGLLAPYAVGEINLQVRYQLM* |
| Ga0102915_11172181 | 3300007562 | Estuarine | IERCVDANRVLVYDQDNNLETTEILVQSITTDEGLLTPYGVGEIYLQVRYAHN* |
| Ga0102915_12752011 | 3300007562 | Estuarine | SLETTEILIQSIMTDEGLLVPYGVGEINLQVRYALQ* |
| Ga0102823_11702721 | 3300007692 | Estuarine | DLEKVIHDNRVLVYDTTNNLSTTEILIQSITTDEGLLAPYGVGEINVQVRYALV* |
| Ga0105736_11554282 | 3300007861 | Estuary Water | DLENVVAANRVLVYDTTNNLSTTEILIQSITTDEGLLTPYGVGEINLQVRYALV* |
| Ga0105747_13325411 | 3300007974 | Estuary Water | TLLHDLETCINDNRVLVYDQANSLETTEILIQSIMTDEGLLVPYGVGEINLQVRYALQ* |
| Ga0104242_10003338 | 3300008962 | Freshwater | GYETTEILIASITTDEGLLSPYAVGEINLQVRYQIV* |
| Ga0102829_11736012 | 3300009026 | Estuarine | SNRVLTYDVATNARTTEILITSIVTDEGLLAPYGVGEINLQVRYQVL* |
| Ga0105152_100333923 | 3300009039 | Lake Sediment | AQTTEILINLVVTDEGLLEPYGVGEINISVQYPVL* |
| Ga0114973_102798512 | 3300009068 | Freshwater Lake | RQLVYDSNNNSTTEILIQSITTDEGLLAPYAVGEINLQVRYQIL* |
| Ga0102812_105699672 | 3300009086 | Estuarine | PQFELETLLHDLETCINDNRVLVYDQANSLETTEILIQSIMTDEGLLVPYGVGEINLQVRYALQ* |
| Ga0114982_12143012 | 3300009419 | Deep Subsurface | VLVYDTVKNYETTEILVQSIVTDEGLLAPYAVGEINLQVRYAIM* |
| Ga0129333_101853691 | 3300010354 | Freshwater To Marine Saline Gradient | GYETTEILIASITTDEGLLAPYAVGEINLQVRYQIM* |
| Ga0129333_108555421 | 3300010354 | Freshwater To Marine Saline Gradient | RELVYDSANGLETTEILIQQITTDEGLLAPYGVGEINLQVRYALE* |
| Ga0129333_114421731 | 3300010354 | Freshwater To Marine Saline Gradient | DSDNNYETTEILIDSITTDEGLLAPYAVGEINLQVRYQIM* |
| Ga0133913_100561906 | 3300010885 | Freshwater Lake | YDSEKNYETTEILVVSITTDEGLLAPYAVGEINLQVRYALM* |
| Ga0139557_10184552 | 3300011010 | Freshwater | NVIDANRVLVYDITNNLSTTEILIQSITTDEGLLNPYGVGEINLQVRYAL* |
| Ga0119951_11501481 | 3300012000 | Freshwater | VDNSLETTEILIQSITTDEGLLAPYGVGEINLQVRYAL* |
| Ga0153799_10425252 | 3300012012 | Freshwater | VIDSSTKLVYNTSANYETTEIIISSVTTDEGLLIPYAVGEINLQVRYQVM* |
| Ga0157210_10290421 | 3300012665 | Freshwater | NLSTTEILIQSITTDEGLLAPYGVGELNLQVRYALV* |
| Ga0157552_11475072 | 3300012728 | Freshwater | DNRQLVYDSINTYSTTEILVQSITTDEGLLAPYAVGEINLQVRYEIM* |
| Ga0129335_11371733 | 3300012962 | Aqueous | VANSLETTEILIQSITTDEGLLAPYGVGEINLEVRYALQ* |
| Ga0129335_11556402 | 3300012962 | Aqueous | LVYDTDNNYETAEILIDSITTDEGLLAPYAVGEINLQVRYQVM* |
| Ga0129337_12823842 | 3300012968 | Aqueous | ETCIDNNRQLVYDSTTGYETTEILIASITTDEGLLAPYAVGEINLQVRYQIM* |
| Ga0164294_104518162 | 3300013006 | Freshwater | SVNNQSTTEILVQSITTDEGLLAPYAVGEINLQVRYQVS* |
| Ga0163212_11154782 | 3300013087 | Freshwater | IYDTTKNHETTEILIDSITTDEGLLTPYAVGEIYLQVRYQIMN* |
| Ga0170791_110488843 | 3300013295 | Freshwater | NRQLVYDSNNNSTTEILIQSITTDEGLLAPYAVGEINLQVRYQIL* |
| Ga0170791_143130601 | 3300013295 | Freshwater | IDKNRQVIYDATNKYSTTEILIQSITTDEGLLAPYAVGEVNLQVRYQVM* |
| Ga0177922_104721981 | 3300013372 | Freshwater | LLEDVETCVDANRVLAYDTITGHETTEILIQSITTDEGLLAPYAVGEINLQVRYAIM* |
| (restricted) Ga0172376_105415572 | 3300014720 | Freshwater | DLETCIDLNRRLVYDDVTNYETTEILIDSITTDEGLLAPYAVGEINLQVRYQIM* |
| Ga0134316_10282362 | 3300014960 | Surface Water | TMVYDNNSNFETTEILVTSITTDEGLLAPYAVGEINLQIRYQLM* |
| Ga0208597_10668631 | 3300020562 | Freshwater | YDQANSLVTTEILIQSIMTDEGLLVPYGVGEMNLQVRYALQ |
| Ga0214163_11251661 | 3300021141 | Freshwater | RDLETCINNNRALVYDQANSLVTTEILIQSIMTDEGLLVPYGVGEMNLQVRYALQ |
| Ga0194130_100291305 | 3300021376 | Freshwater Lake | NRTLVYDADTGADTTEILVVSIVTDEGVLAPYAIGEINLQVRYDIM |
| Ga0222714_102223032 | 3300021961 | Estuarine Water | NNHETTEILIDSITTDEGLLAPYAVGEINLQVRYQVM |
| Ga0222714_105191242 | 3300021961 | Estuarine Water | YDSVNNYETTEILIQSITTDEGLLYPYAIGEINLHVRYAIM |
| Ga0222713_107827662 | 3300021962 | Estuarine Water | LVYDLDNNHETTEILIDSITTDEGLLAPYAVGEINLQVRYQVM |
| Ga0228698_10059881 | 3300022745 | Freshwater | LEKCVNNNRVLVYDQENGLETTEILVQSIITDEGLLHPYAVGEINLQVRYALM |
| Ga0214917_101139953 | 3300022752 | Freshwater | GYETTEILIASITTDEGLLSPYAVGEINLQVRYQIM |
| Ga0244775_102009051 | 3300024346 | Estuarine | YTTTEILVQSITTDEGLLYPYAIGEINLQVRYEIL |
| Ga0244775_102216951 | 3300024346 | Estuarine | VLVYDDTNNYETTEILLTSITTDEGLLAPYAIGEINLQVRYQIMQ |
| Ga0244776_107957782 | 3300024348 | Estuarine | LENVVDANRVLVYDATNNLSTTEILIQSITTDEGLLTPYGVGEINLQVRYALV |
| Ga0255265_11065322 | 3300024482 | Freshwater | HETTEILIDSITTDEGLLAPYAVGEINLQVRYQIM |
| Ga0255143_10527462 | 3300024500 | Freshwater | LADIEHVIDNNRVLVYDTVNNYETTEILIQEITTDEGLLAPYAIGEINLQVRYELV |
| Ga0256347_11244532 | 3300024545 | Freshwater | YETTEILIASITTEEGLLAPYAVGEINLQVRYQIM |
| Ga0255301_10126542 | 3300024553 | Freshwater | LETCIDANRQLIYDADKNYETTEIFIDSITTDEGLLAPYAVGEINLQVRYQIM |
| Ga0255280_10382302 | 3300024555 | Freshwater | YDSDNNYETTEILIDSITTDEGLLAPYAVGEINLQVRYQIM |
| Ga0255283_11479861 | 3300024557 | Freshwater | QLVYDSTNVYTTTEILIDSITTDEGLLAPYAVGEINLQVRYQIM |
| Ga0255273_10136741 | 3300024565 | Freshwater | LEQLLEDIEKVIHDNRVLVYDAVNNFETTEILVQSITTDEGLLKPYAVGEMNIQVRYALT |
| Ga0256340_10844621 | 3300024865 | Freshwater | YDAVNNFETTEILVQSITTDEGLLKPYAVGEMNIQVRYALT |
| Ga0210042_11984992 | 3300025032 | Aquifer | NNYETTEILVASITTDEGLLAPYAVGEINLQVRYQLM |
| Ga0210041_10999351 | 3300025034 | Aquifer | VESVIDANRVLVYDSVNNYETTEILVASITTDEGLLAPYAVGEINLQVRYQLM |
| Ga0255239_10080272 | 3300025756 | Freshwater | DANRVLEYSPGKTTTEILVTSITTDEGLLAPYGVGEINLQVRYAL |
| Ga0210015_10442811 | 3300025831 | Aquifer | YDIVNNYETTEILVVSITTDEGLLAPYAVGEINLQVRYQLM |
| Ga0208916_102860621 | 3300025896 | Aqueous | YDTEKNYETTEILVASITTDEGLLAPYAVGEINLQVRYQLM |
| Ga0255308_10167801 | 3300026422 | Freshwater | NNLSTTEILIQQITTDEGLLAPYGVGEINLQVRYALE |
| Ga0255277_11378411 | 3300026569 | Freshwater | INNNRVLVYDTTNNLSTTEILIQSITTDEGLLAPYGVGEINLQVRYALV |
| Ga0255269_11364591 | 3300026573 | Freshwater | NNRVLVYDTTNNLSTTEILIQSITTDEGLLAPYGVGEINLQVRYALV |
| Ga0255104_10251322 | 3300027146 | Freshwater | NKNLVYDATKDLITTEILVVSITTDEGLLKPYAVGEINIQVRYQVMYV |
| Ga0208931_10745802 | 3300027246 | Estuarine | DLENCIHNNRVLVYDQANSLETTEILIQSIMTDEGLLVPYGVGEINLQVRYALQ |
| Ga0208811_11098421 | 3300027314 | Estuarine | IERCVDANRVLVYDQDNNLETTEILVQSITTDEGLLTPYGVGEIYLQVRYAHN |
| Ga0208923_10403261 | 3300027320 | Estuarine | TNNLSTTEILIQSITTDEGLLAPYGVGELNLQVRYALV |
| Ga0208022_10801642 | 3300027418 | Estuarine | NRVLVYDTTNNLSTTEILIQSITTDEGLLAPYGVGEINVQVRYALV |
| Ga0209552_11830841 | 3300027563 | Freshwater Lake | VYDITNNLSTTEILIQSITTDEGLLNPYGVGEINLQVRYAL |
| Ga0209651_10395091 | 3300027581 | Freshwater Lake | LLHDLETCINDNRVLVYDQANSLETTEILIQSIMTDEGLLVPYGVGEINLQVRYALQ |
| Ga0255117_10556651 | 3300027600 | Freshwater | KDLITTEILVVSITTDEGLLKPYAVGEINIQVRYQVMYV |
| Ga0208133_11694901 | 3300027631 | Estuarine | TVINDNRVLVYDITNNLSTTEILIQSITTDEGLLAPYGVGEINLQVRYAL |
| Ga0208975_10901822 | 3300027659 | Freshwater Lentic | LVYDTTNNLSTTEILIQSITTDEGLLAPYGVGELNLQVRYALV |
| Ga0209599_100158841 | 3300027710 | Deep Subsurface | VYDSTNNFETTEILIQSITTDEGLLYPYAVGEINLQVRYQVM |
| Ga0209599_101614982 | 3300027710 | Deep Subsurface | VLVYDTVKNYETTEILVQSIVTDEGLLAPYAVGEINLQVRYAIM |
| Ga0209582_12920851 | 3300027724 | Activated Sludge | RVLVYDTVNNYDTTEILITSITTDEGLLAPYAVGEINLQVRYAIM |
| Ga0209246_101074442 | 3300027785 | Freshwater Lake | VNNYETTEILLQSITTDEGLLAPYAIGEVNLQVRYQLM |
| Ga0209246_102235571 | 3300027785 | Freshwater Lake | TVINNNRILVYDVTNNLSTTEILIQSITTDEGLLAPYGVGEINLQVRYALV |
| Ga0209476_102569501 | 3300027802 | Activated Sludge | NSQTTEILVNSINTDEGLLSPYAVGEIVLQVRYAR |
| Ga0209354_102039381 | 3300027808 | Freshwater Lake | LVYDSANNYQTTEILVQSITTDEGLLAPYAVGEINLQVRYAIM |
| Ga0209990_104757352 | 3300027816 | Freshwater Lake | DANRVLVYDETNGYETTEILITSITTDEGLLAPYAVGEINLQVRYPIM |
| Ga0209230_107302012 | 3300027836 | Freshwater And Sediment | NNLSTTEILIQSITTDEGLLAPYGVGEINLQVRYALV |
| Ga0209191_13610092 | 3300027969 | Freshwater Lake | TDITHNFETIEILVQSITTDEGLLYPYAIGEINLQVRYQVM |
| Ga0256362_10783671 | 3300028096 | Freshwater | LLEDLERCIDANRQLVYDTDNNYETTEILIDSITTDEGLLAPYAVGEINLQVRYQIM |
| Ga0256363_10049593 | 3300028100 | Freshwater | ERCIDANRQLVYDTDNNYETTEILIDSITTDEGLLAPYAVGEINLQVRYQIM |
| Ga0304730_12106032 | 3300028394 | Freshwater Lake | ALLTDIEKCIHDNRDLVYDSNNNSTTEILIQSITTDEGLLAPYAIGEINLQVRYQVL |
| Ga0315274_100381435 | 3300031999 | Sediment | KGVIIYDTTHNYDTAEISITSITTDEGLLAPYSVGEMNLLVRYQVM |
| Ga0315905_104950651 | 3300032092 | Freshwater | DANRVLVYDITNNLSTTEILIQSITTDEGLLTPYGVGEINLQVRYAL |
| Ga0334977_0167104_1002_1127 | 3300033978 | Freshwater | YDTDNNHETTEILIDSITTDEGLLAPYAVGEINLQVRYQIM |
| Ga0334998_0740871_2_157 | 3300034019 | Freshwater | NCIDANRQLVYNSTTGYETTEILIASITTDEGLLAPYAVGEINLQVRYQIM |
| Ga0310127_135657_858_995 | 3300034072 | Fracking Water | NTLVYDPLTGKDITEITIISIVTDEGILAPYAVGEINLQVRYDIV |
| Ga0335012_0368172_531_710 | 3300034093 | Freshwater | ENLLDDLENVLDANRVLVYDTTNNLSTTEILIQSITTDEGLLAPYGVGEINLQVRYALV |
| ⦗Top⦘ |