NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F101471

Metagenome / Metatranscriptome Family F101471

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F101471
Family Type Metagenome / Metatranscriptome
Number of Sequences 102
Average Sequence Length 66 residues
Representative Sequence MKTLIATATLTIMFLSAGAFAGNDTQMATVAKSQISNVTVITKNGQWPVKGQTSFDACSVRRCLDA
Number of Associated Samples 97
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 71.57 %
% of genes near scaffold ends (potentially truncated) 24.51 %
% of genes from short scaffolds (< 2000 bps) 90.20 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction Yes
3D model pTM-score0.17

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (66.667 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil
(15.686 % of family members)
Environment Ontology (ENVO) Unclassified
(42.157 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Subsurface (non-saline)
(39.216 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 15.96%    β-sheet: 0.00%    Coil/Unstructured: 84.04%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.17
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF08281Sigma70_r4_2 4.90
PF02787CPSase_L_D3 1.96
PF10099RskA 1.96
PF02786CPSase_L_D2 1.96
PF04542Sigma70_r2 1.96
PF00486Trans_reg_C 0.98
PF00149Metallophos 0.98
PF00171Aldedh 0.98
PF028262-Hacid_dh_C 0.98
PF05226CHASE2 0.98
PF14588YjgF_endoribonc 0.98
PF13670PepSY_2 0.98
PF00289Biotin_carb_N 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 1.96
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 1.96
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 1.96
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 1.96
COG0014Gamma-glutamyl phosphate reductaseAmino acid transport and metabolism [E] 0.98
COG1012Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenaseLipid transport and metabolism [I] 0.98
COG4230Delta 1-pyrroline-5-carboxylate dehydrogenaseAmino acid transport and metabolism [E] 0.98
COG4252Extracytoplasmic sensor domain CHASE2 (specificity unknown)Signal transduction mechanisms [T] 0.98


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms66.67 %
UnclassifiedrootN/A33.33 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090001|CNB_F6ESG4R02JGWU5Not Available529Open in IMG/M
2124908045|KansclcFeb2_ConsensusfromContig809481All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → unclassified Phyllobacteriaceae → Phyllobacteriaceae bacterium718Open in IMG/M
3300000956|JGI10216J12902_106810785All Organisms → cellular organisms → Bacteria → Proteobacteria1368Open in IMG/M
3300004114|Ga0062593_102955375All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300004463|Ga0063356_100075558All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium3529Open in IMG/M
3300004479|Ga0062595_100376788All Organisms → cellular organisms → Bacteria → Proteobacteria1003Open in IMG/M
3300005347|Ga0070668_100048881All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3254Open in IMG/M
3300005406|Ga0070703_10461402All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aestuariivirgaceae → Aestuariivirga → Aestuariivirga litoralis565Open in IMG/M
3300005655|Ga0073905_10035604All Organisms → cellular organisms → Bacteria → Proteobacteria2373Open in IMG/M
3300005659|Ga0073900_10122813All Organisms → cellular organisms → Bacteria → Proteobacteria1183Open in IMG/M
3300005844|Ga0068862_101845700All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aestuariivirgaceae → Aestuariivirga → Aestuariivirga litoralis614Open in IMG/M
3300006046|Ga0066652_100321117All Organisms → cellular organisms → Bacteria → Proteobacteria1383Open in IMG/M
3300006195|Ga0075366_10618225Not Available672Open in IMG/M
3300006881|Ga0068865_101619842All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aestuariivirgaceae → Aestuariivirga → Aestuariivirga litoralis582Open in IMG/M
3300009032|Ga0105048_10145097All Organisms → cellular organisms → Bacteria → Proteobacteria2994Open in IMG/M
3300009053|Ga0105095_10415662All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aestuariivirgaceae → Aestuariivirga → Aestuariivirga litoralis743Open in IMG/M
3300009147|Ga0114129_11236307Not Available929Open in IMG/M
3300009448|Ga0114940_10202310Not Available874Open in IMG/M
3300009553|Ga0105249_10315732All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aestuariivirgaceae → Aestuariivirga → Aestuariivirga litoralis1572Open in IMG/M
3300009553|Ga0105249_12617120Not Available577Open in IMG/M
3300009803|Ga0105065_1042879Not Available620Open in IMG/M
3300009873|Ga0131077_10028463All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria8946Open in IMG/M
3300010045|Ga0126311_11472353Not Available570Open in IMG/M
3300010400|Ga0134122_10209399All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1622Open in IMG/M
3300011406|Ga0137454_1035336All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → unclassified Phyllobacteriaceae → Phyllobacteriaceae bacterium747Open in IMG/M
3300011408|Ga0137460_1013472All Organisms → cellular organisms → Bacteria → Proteobacteria1216Open in IMG/M
3300011421|Ga0137462_1192851Not Available506Open in IMG/M
3300011424|Ga0137439_1053122All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aestuariivirgaceae → Aestuariivirga → Aestuariivirga litoralis788Open in IMG/M
3300011436|Ga0137458_1016703All Organisms → cellular organisms → Bacteria → Proteobacteria1761Open in IMG/M
3300012040|Ga0137461_1207663All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aestuariivirgaceae → Aestuariivirga → Aestuariivirga litoralis574Open in IMG/M
3300012225|Ga0137434_1006561All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aestuariivirgaceae → Aestuariivirga → Aestuariivirga litoralis1221Open in IMG/M
3300012226|Ga0137447_1013001All Organisms → cellular organisms → Bacteria → Proteobacteria1173Open in IMG/M
3300012227|Ga0137449_1098939All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aestuariivirgaceae → Aestuariivirga → Aestuariivirga litoralis634Open in IMG/M
3300012227|Ga0137449_1135725Not Available539Open in IMG/M
3300012231|Ga0137465_1195143Not Available609Open in IMG/M
3300012668|Ga0157216_10175248All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1025Open in IMG/M
3300014862|Ga0180096_1002483All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aestuariivirgaceae → Aestuariivirga → Aestuariivirga litoralis1035Open in IMG/M
3300014870|Ga0180080_1086429Not Available550Open in IMG/M
3300015201|Ga0173478_10844753All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300015251|Ga0180070_1016694Not Available838Open in IMG/M
3300015253|Ga0180081_1032732Not Available838Open in IMG/M
3300015254|Ga0180089_1035975Not Available948Open in IMG/M
3300015360|Ga0163144_11649330Not Available553Open in IMG/M
3300017997|Ga0184610_1160152Not Available742Open in IMG/M
3300018028|Ga0184608_10133743All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aestuariivirgaceae → Aestuariivirga → Aestuariivirga litoralis1060Open in IMG/M
3300018059|Ga0184615_10255203All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aestuariivirgaceae → Aestuariivirga → Aestuariivirga litoralis982Open in IMG/M
3300018063|Ga0184637_10101025All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aestuariivirgaceae → Aestuariivirga → Aestuariivirga litoralis1776Open in IMG/M
3300018066|Ga0184617_1007580All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aestuariivirgaceae → Aestuariivirga → Aestuariivirga litoralis2047Open in IMG/M
3300018078|Ga0184612_10424743Not Available665Open in IMG/M
3300018079|Ga0184627_10156892All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1206Open in IMG/M
3300018429|Ga0190272_11037329Not Available787Open in IMG/M
3300018429|Ga0190272_11965121Not Available618Open in IMG/M
3300018469|Ga0190270_11323792All Organisms → cellular organisms → Bacteria764Open in IMG/M
3300018476|Ga0190274_11497646Not Available766Open in IMG/M
3300018481|Ga0190271_13059302Not Available561Open in IMG/M
3300019212|Ga0180106_1132746All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aestuariivirgaceae → Aestuariivirga → Aestuariivirga litoralis569Open in IMG/M
3300019232|Ga0180114_1383412All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → unclassified Phyllobacteriaceae → Phyllobacteriaceae bacterium573Open in IMG/M
3300019238|Ga0180112_1268514All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aestuariivirgaceae → Aestuariivirga → Aestuariivirga litoralis745Open in IMG/M
3300019244|Ga0180111_1128520Not Available500Open in IMG/M
3300019244|Ga0180111_1387662All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aestuariivirgaceae → Aestuariivirga → Aestuariivirga litoralis649Open in IMG/M
3300019269|Ga0184644_1099826All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aestuariivirgaceae → Aestuariivirga → Aestuariivirga litoralis695Open in IMG/M
3300019377|Ga0190264_11899972Not Available541Open in IMG/M
3300019487|Ga0187893_10321794All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aestuariivirgaceae → Aestuariivirga → Aestuariivirga litoralis1089Open in IMG/M
3300020063|Ga0180118_1216959Not Available543Open in IMG/M
3300020065|Ga0180113_1033591All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → unclassified Phyllobacteriaceae → Phyllobacteriaceae bacterium556Open in IMG/M
3300020067|Ga0180109_1349809All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aestuariivirgaceae → Aestuariivirga → Aestuariivirga litoralis671Open in IMG/M
3300020068|Ga0184649_1083090All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300021090|Ga0210377_10774910Not Available521Open in IMG/M
3300021339|Ga0193706_1123091Not Available706Open in IMG/M
3300022756|Ga0222622_11413409Not Available512Open in IMG/M
3300025313|Ga0209431_10192778All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aestuariivirgaceae → Aestuariivirga → Aestuariivirga litoralis1612Open in IMG/M
3300025325|Ga0209341_10164030All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1867Open in IMG/M
3300025935|Ga0207709_11170684All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aestuariivirgaceae → Aestuariivirga → Aestuariivirga litoralis633Open in IMG/M
3300025942|Ga0207689_11828560Not Available501Open in IMG/M
3300025972|Ga0207668_10139873All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1860Open in IMG/M
3300026325|Ga0209152_10391296All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium543Open in IMG/M
3300027724|Ga0209582_1268690All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300027841|Ga0209262_10397555All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aestuariivirgaceae → Aestuariivirga → Aestuariivirga litoralis672Open in IMG/M
3300027897|Ga0209254_10800629Not Available638Open in IMG/M
3300027959|Ga0209477_1091822All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1067Open in IMG/M
3300031096|Ga0308193_1040671All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aestuariivirgaceae → Aestuariivirga → Aestuariivirga litoralis672Open in IMG/M
3300031152|Ga0307501_10255020All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300031548|Ga0307408_101753565Not Available593Open in IMG/M
3300031730|Ga0307516_10082619All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3054Open in IMG/M
3300031731|Ga0307405_10194186All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1469Open in IMG/M
3300031834|Ga0315290_10263784All Organisms → cellular organisms → Bacteria → Proteobacteria1505Open in IMG/M
3300031911|Ga0307412_10681138Not Available880Open in IMG/M
3300031997|Ga0315278_10880841All Organisms → cellular organisms → Bacteria899Open in IMG/M
3300032002|Ga0307416_101098879All Organisms → cellular organisms → Bacteria → Proteobacteria900Open in IMG/M
3300032012|Ga0310902_10336080All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales942Open in IMG/M
3300032143|Ga0315292_10014640All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria5182Open in IMG/M
3300032397|Ga0315287_10058403All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4262Open in IMG/M
3300032401|Ga0315275_12600082Not Available522Open in IMG/M
3300032420|Ga0335397_10048131All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4705Open in IMG/M
3300033814|Ga0364930_0091525All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aestuariivirgaceae → Aestuariivirga → Aestuariivirga litoralis1038Open in IMG/M
3300034126|Ga0370486_191664All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300034127|Ga0370489_0047951All Organisms → cellular organisms → Bacteria → Proteobacteria1237Open in IMG/M
3300034155|Ga0370498_048851Not Available936Open in IMG/M
3300034178|Ga0364934_0063705All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aestuariivirgaceae → Aestuariivirga → Aestuariivirga litoralis1369Open in IMG/M
3300034194|Ga0370499_0019500All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1561Open in IMG/M
3300034643|Ga0370545_020037Not Available1115Open in IMG/M
3300034643|Ga0370545_088031All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aestuariivirgaceae → Aestuariivirga → Aestuariivirga litoralis659Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil15.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil11.76%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment10.78%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment6.86%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment4.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.92%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil3.92%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere3.92%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge3.92%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater1.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.96%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil1.96%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.96%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.98%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.98%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat0.98%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater0.98%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater0.98%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.98%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.98%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.98%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.98%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.98%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.98%
Microbial Mat On RocksEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks0.98%
Quercus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere0.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.98%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.98%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.98%
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza0.98%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.98%
WastewaterEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater0.98%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090001Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNBHost-AssociatedOpen in IMG/M
2124908045Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011EnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005655Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_supernatantEngineeredOpen in IMG/M
3300005659Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB5-KitEngineeredOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006195Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300009032Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-05EnvironmentalOpen in IMG/M
3300009053Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009448Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Cold Creek SourceEnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009803Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50EnvironmentalOpen in IMG/M
3300009873Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plantEngineeredOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011406Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT539_2EnvironmentalOpen in IMG/M
3300011408Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT723_2EnvironmentalOpen in IMG/M
3300011421Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT769_2EnvironmentalOpen in IMG/M
3300011424Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT200_2EnvironmentalOpen in IMG/M
3300011436Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2EnvironmentalOpen in IMG/M
3300012040Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2EnvironmentalOpen in IMG/M
3300012225Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT860_2EnvironmentalOpen in IMG/M
3300012226Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT400_2EnvironmentalOpen in IMG/M
3300012227Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT436_2EnvironmentalOpen in IMG/M
3300012231Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT828_2EnvironmentalOpen in IMG/M
3300012668Arctic soils microbial communities. Combined Assembly of 23 SPsEnvironmentalOpen in IMG/M
3300014862Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293_16_1DaEnvironmentalOpen in IMG/M
3300014870Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT560_16_10DEnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015251Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293_16_10DEnvironmentalOpen in IMG/M
3300015253Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT590_16_10DEnvironmentalOpen in IMG/M
3300015254Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10DEnvironmentalOpen in IMG/M
3300015360Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1EnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018059Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coexEnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018066Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1EnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019212Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT25_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019232Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT530_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019238Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT466_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019244Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT293_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019269Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300019487White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaGEnvironmentalOpen in IMG/M
3300020063Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT730_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020065Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT499_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020067Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT47_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020068Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021090Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redoEnvironmentalOpen in IMG/M
3300021339Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c1EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025313Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes)EnvironmentalOpen in IMG/M
3300025325Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300027724Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB5-Kit (SPAdes)EngineeredOpen in IMG/M
3300027841Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 (SPAdes)EnvironmentalOpen in IMG/M
3300027897Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes)EnvironmentalOpen in IMG/M
3300027959Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_supernatant (SPAdes)EngineeredOpen in IMG/M
3300031096Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_194 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031152Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_SEnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031730Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EMHost-AssociatedOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300031911Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1Host-AssociatedOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032143Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0EnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300032420Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (spades assembly)EnvironmentalOpen in IMG/M
3300033814Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17EnvironmentalOpen in IMG/M
3300034126Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_16EnvironmentalOpen in IMG/M
3300034127Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_16EnvironmentalOpen in IMG/M
3300034155Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_17EnvironmentalOpen in IMG/M
3300034178Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17EnvironmentalOpen in IMG/M
3300034194Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_17EnvironmentalOpen in IMG/M
3300034643Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_120 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
CNB_013803202088090001Quercus RhizosphereMKTLIATATLTIMFLSAGAFAGNGIQMATLAKSQISNVTVIIKNGQWPVKGQTSFDACSVRRCLDA
KansclcFeb2_068637202124908045SoilMKTLIATATLTIMFLSAGAFAGNDTKMETVAKSPISNVTVIIKNGQWPVKGQTSLDACSVRRCLDA
JGI10216J12902_10681078543300000956SoilMKTVLATATLTIMFLSAGAFAGNDTRTAPVAESQVANVTVIAKNGQWPVKGQISLDACSVRRCLDA*
Ga0062593_10295537513300004114SoilEETKMKTVLATATLTIMFLSAGAFAGNDTHTAPVAKSQITNVTVIAKNGQWPVKGQISLDACSVRRCLDA*
Ga0063356_10007555853300004463Arabidopsis Thaliana RhizosphereMKTLIATATLTIMFLSAGAFAGNDTKMETIAKSPISNVTVIIKNGQWPVKGQTSFDACSVRRCLDA*
Ga0062595_10037678813300004479SoilMKTVLATATLTIMFLSAGAFAGNDTHTAPVAKSQITNVTVIAKNGQWPVKGQISLDACSVRRCLDA*
Ga0070668_10004888133300005347Switchgrass RhizosphereMKTVLATATLTIMFLSAGAFAGNDTHTAPVAKSQITNVTVIAKNGQWPVKGQISLDACLVRRCLDA*
Ga0070703_1046140213300005406Corn, Switchgrass And Miscanthus RhizosphereTLTIMFLSAGAFAGNDTHTAPVAKSQITNVTVIAKNGQWPVKGQISLDACSVRRCLDA*
Ga0073905_1003560433300005655Activated SludgeMKTLIATATLTIMFLSAGAFAGNDIKMASGAKPQVSNVTVILKNGQWPVKGQTSFDACSVRRCLDA*
Ga0073900_1012281313300005659Activated SludgeMKTLIATATLTIMFLSVGAFAGNDIKMASGAKPQVSNVTVILKNGQWPVKGQTSFDACSVRRCLDA*
Ga0068862_10184570013300005844Switchgrass RhizosphereIMFLSAGAFAGNDTHTAPVAKSQITNVTVIAKNGQWPVKGQISLDACLVRRCLDA*
Ga0066652_10032111723300006046SoilMKTLIATTTLTIMFLSAGAFAGNDIQMATVAKSPISNVTVITKNGQWPAKGQTSFDACSVKRCLDA*
Ga0075366_1061822513300006195Populus EndosphereMKTLIATATLTIMFLSAGAFAGNDIQMATLAKSPISNVTVIIKNGQWPVKGQTSLDACSI
Ga0068865_10161984213300006881Miscanthus RhizosphereKMKTVLATATLTIMFLSAGAFAGNDTHTAPVAKSQITNVTVIAKNGQWPVKGQISLDACLVRRCLDA*
Ga0105048_1014509733300009032FreshwaterMKTLIATATLTIMFLSAGAFAGNDTHMATVAKAPISNVTVITKNGQWPVKGQTSFDACSVRRCLDA*
Ga0105095_1041566213300009053Freshwater SedimentMKTVLATATLTIMFLSAGAFAGNDTRTAPVAKSQVTNVTVIAKNGQWPVKGQISLDACSVRRCLDA*
Ga0114129_1123630713300009147Populus RhizosphereMKTLIATATLTVMFLSAGAFAGNDMTAATVAKSQISNVTVIAKNGQWPVKGQTSFDACSVRRCLDA*
Ga0114940_1020231023300009448GroundwaterMKTLIATATLTIMFLSAGAFAGNDTQMATVAKSQISNVTVIIKNGQWPVKGQTSFDACSVRRCLDA*
Ga0105249_1031573233300009553Switchgrass RhizosphereMKTVLATASLTIMFLSAGAFAGIETKIAAVATPPVTNVTVIAKNGQWPVKGQISLDACLVRRCLDA*
Ga0105249_1261712013300009553Switchgrass RhizosphereMKTLIATATLTIMFLSAGAFAGNDIQMATLAKSPISNVTVIIKNGQWPVKGQTSLDACSIRRCLDA*
Ga0105065_104287923300009803Groundwater SandMKTALATAALTIMFLSAGAFAGNDTQTTPVAKSQITNVTVIAKNGQWPVKGQTSLDACSVRRCLDA*
Ga0131077_1002846333300009873WastewaterMKTLIATATLTIMFLSAGAFAGNDIKMASGAKHQVSNVTVILKNGQWPVKGQTSFDACSVRRCLDA*
Ga0126311_1147235313300010045Serpentine SoilMKTLIATATLTIMFLSAGAFAGNDNQMATLAKTPISNVTVITKNGQWPMKGQTSLDACSVRRCLDA*
Ga0134122_1020939913300010400Terrestrial SoilMKTVLATASLTIMFLSAGAFAGIETKIAAVATPPVTNVTVIAKNGQWPVKGQISLDACSVRRCLDA*
Ga0137454_103533623300011406SoilMKTVIATATLTIMFLSAGAFAGNDTRTAPVAKSEITNVTVIIKNGQWPVKGQISVDACSLRRCMDA*
Ga0137460_101347233300011408SoilMKTVIATATLAIMFLSAGAFAGNDTRTAPVAKSEITNVTVITKNGQWPVKGQISFDACSLRRCMDA*
Ga0137462_119285113300011421SoilMKTLIATATLTIMFLSAGAFAGNDTRTAPVAKSEITNVTVIIKNGQWPVKGQLSVDACSLRRCMDA*
Ga0137439_105312223300011424SoilMKTLIATATLTIMFLSAGAFAGNDIQMATVAKTPISNVTVIIKNGQWPVKGQTSFDACSVRRCLDA*
Ga0137458_101670333300011436SoilMKTVIATATLAIMFLSAGAFAGNDTRTAPVAKSEITNVTVIIKNGQWPVKGQISVDACSLRRCMDA*
Ga0137461_120766313300012040SoilTATLTIMFLSAGAFAGNDLPSAPVAKSQITNVTVIAKNGQWPVKGQISLDACSVRRCLDA
Ga0137434_100656123300012225SoilMKTLLATATLTIMFLSAGAFAGNDLPSAPVVNSHITNVTVISKNGQWPVIGQISLDACSVRRCLDA*
Ga0137447_101300113300012226SoilMKTVLATATLTIMFLSAGAFAGNDLPSAPVAKSQITNVTVITKNGQWPVKGQTSFDACSVRRCLDA*
Ga0137449_109893923300012227SoilMKTVIATATLTIMFLSAGAFAGNDTRTAPVAKSEITNVTVITKNGQWPVKGQISFDACSLRRCMDA*
Ga0137449_113572513300012227SoilMKTVIATATLTIMFLSAGAFAGNDTQTAPVAKSHITNVTVIAKNGQWPVKGQISFDACSVRRCLDA*
Ga0137465_119514323300012231SoilMKTLIVTATLTIMFLSAGAFAGNDIQMATAAKSQISNVTVITKNGQWPVKGQTSFDACSVRRCVDA*
Ga0157216_1017524833300012668Glacier Forefield SoilMKTLIATATLTIMFLSAGAFAGNDIQMATVANTQISNVTVIIKNGQWPVKGQTSFDACSVRRCLDA*
Ga0180096_100248323300014862SoilMKTLLATATLTIMFLSAGAFAGNDTRTAPVAKSEITNVTVIIKNGQWPVKGQISVDACSLRRCMDA*
Ga0180080_108642923300014870SoilMKTVIATATLAIMFLSAGAFAGNDTRTAPVAKSEITNVTVIIKNGQWPVKGQISFDACSLRRCMDA*
Ga0173478_1084475313300015201SoilLTIMFLSAGAFAGNDTKMETVAKSPISNVTVIIKNGQWPVKGQTSFDACSVRRCLDA*
Ga0180070_101669413300015251SoilMKTLLATATLTIMFLSAGAFAGNETLTAPVAKSQITNVTVIAKNGQWPVKVHESLDACSVRRCLDA*
Ga0180081_103273223300015253SoilMKTLIATATLTIMFLSAGAFAGNDTQMATAAKSQISNVTVITKNGQWPVKGQTSFDACSVRRCLDA*
Ga0180089_103597533300015254SoilMKTVLATATLTIMFLSAGAFAGNDMTAATTARSQISNVTVIAKNGHWPVKGQTSFDACSVRRCLDA*
Ga0163144_1164933013300015360Freshwater Microbial MatMKTLIATATLTIMFLSAGAFAGNDTQMATVAKSQISNVTVITKNGQWPVKGQTSFDACSVRRCLDA*
Ga0184610_116015223300017997Groundwater SedimentMKTVLATATLTIMFLSAGAFAGNDMPSAPVAKSQITNVTVIAKNGQSPVKGQISLDACSLRRCLDA
Ga0184608_1013374313300018028Groundwater SedimentMKTALATATLTIMFLSAGAFAGNDTHTAPVAKSQITNVTVIAKNGQWPVKGQISLDACSLRRCLDA
Ga0184615_1025520323300018059Groundwater SedimentMKTLIATATLTIMFLSAGAFAGNDTQTAPVAKSQITNVTVIAKNGQWPVKGQISLDACSVRRCLDA
Ga0184637_1010102523300018063Groundwater SedimentMKTVLATATLAIMFLSAGAFAGNDTQTASVAKSQITNVTVISKNGQWPVNGQISFDACSIRRCLDA
Ga0184617_100758023300018066Groundwater SedimentMKTLIATATLTIMFLSAGAFAGNDIQMATLAKSAISNVTVIIKNGQWPVKGQTSFDACSVRRCLDA
Ga0184612_1042474323300018078Groundwater SedimentMKTLIATATLTIMFLSAGAFAGNDTQMATVAKSQISNVTVIIKNGQWPVKGQTSFDACSVRRCLDA
Ga0184627_1015689233300018079Groundwater SedimentMKTVLATATLAIMFLSAGAFAGNDTQTASVTKSQITNVTVISKNGQWPVKGQISFDACSLRRCLDA
Ga0190272_1103732923300018429SoilMKTVLATATLTIMFLSAGAFAGNDTQTAPVAKSQVTNVTVIAKNGQWPVKGQISLDACSVRRCLDA
Ga0190272_1196512113300018429SoilMKTLIATATLTIMFLSAGAFAGNDIQMATVAKTPISNVTVIIKNGQWPVKGQTSFDACSVRRCLDA
Ga0190270_1132379223300018469SoilMKTLIATATLTIMFLSAGAFAGNDNQMATVAKSPISNVTVITKNGQWPVKGQTSFDACSVRRCLDA
Ga0190274_1149764613300018476SoilMKTLIATATLTIMFLSAGAFAGNDMPMATLAKAPISNMTVIIKNGQWPVKGQTSFDACSVRRCLDA
Ga0190271_1305930213300018481SoilMKTLIATATLTIMFLSAGAFAGNDIQMATLVKSPISNVTVITKNGQWPVKGQTSLDACSVRRCLDA
Ga0180106_113274613300019212Groundwater SedimentPLSLEETKMKTVLATAALTIMFLSAGAFAGNDTQKAPVAKSHITNVTVISKNGQWPVKGQISLDACSVRRCLDA
Ga0180114_138341223300019232Groundwater SedimentSLKETKMKTLIATATLTVMFLSAGAFAGNDMTAATSAKSQISNVTVITKNGQWPVKGQTSFDACSVRRCLDA
Ga0180112_126851413300019238Groundwater SedimentKMKTLIATATLTIMFLSAGAFAGNDIQMATVAKSQISNVTVITKNGQWPVKGQTSFDACSVRRCLDA
Ga0180111_112852013300019244Groundwater SedimentRLWRRHKMKTVIATATLTIMFLSAGAFAGNDTRTAPVAKSEITNVTVIIKNGQWPVKDQISVDACSLRRCMDA
Ga0180111_138766213300019244Groundwater SedimentMKTLIATATLTIMFLSAGAFAGNDIQMATAAKSQISNVTVIIKNGQWPVKGQTSFDACSVRRCLDA
Ga0184644_109982613300019269Groundwater SedimentHSLWRRHKMKTLIATATLTIMFLSVGAFAGNDIQMAKVAKSQISNVTVITKNGQWPVKGQTSFNACSVRRCLDA
Ga0190264_1189997223300019377SoilMKTLIATATLTIMFLSAGAFAGSDIQMATLAKSPISKVTIITKNGQWPVKGQTSFDACSVRRCLDA
Ga0187893_1032179423300019487Microbial Mat On RocksMKTLIATATLTIMFLSAGAFAGNDIPMATLVKSPISKVTVIIKNGQWPVKGQTSFDACSVRRCLDA
Ga0180118_121695913300020063Groundwater SedimentMKTLLATATLTIMFLSAGAFAGNDTRTAPVAKSEITNVTVIIKNGQWPVKGQISVDACSLRRCMDA
Ga0180113_103359113300020065Groundwater SedimentKMKTLIATATLTIMFLSAGAFAGNDIQMATVAKTPISNVTVIIKNGQWPVKGQTSFDACSVRRCLDA
Ga0180109_134980923300020067Groundwater SedimentPQSLEETKMKTVLATATLTIMFLSAGAFAGNDLPSAPVAKSQITNVTVISKNGQWPVKGQISLDACSVRRCLDA
Ga0184649_108309013300020068Groundwater SedimentTLTIMFLSAGAFAGNDTRTAPVAKSQITNVTVIAKNGQWPVKGQISLDACSVRRCLDA
Ga0210377_1077491013300021090Groundwater SedimentMKTLLATATLTIMFLSAGAFAGNDTQTAPVAKFQITNVTVIAKNGQWPVKGQISFDACSIRRCMDA
Ga0193706_112309123300021339SoilMKTLIATATLTIMFLSAGAFAGNDLQMATLAKSQISNVTVITKNGQWPVKGQISFDACSVRRCLDA
Ga0222622_1141340923300022756Groundwater SedimentMKTLIATATLTIMFLSAGAFAANDIKMATVAKSQISNVTVITKNGQWPMKGQTSLDACSVRRCLDA
Ga0209431_1019277833300025313SoilMKTVIATATLTIMFLSAGAFAGNDTRTAPLAKSEITNVTVISKNGQWPVKGQISVDACSLRRCMDA
Ga0209341_1016403013300025325SoilFLSAGAFAGNDTLTAPLAKSEITNVTVISKNGQWPVKGQISVDACSLRRCMDA
Ga0207709_1117068413300025935Miscanthus RhizosphereVLATATLTIMFLSAGAFAGNDTHTAPVAKSQITNVTVIAKNGQWPVKGQISLDACSVRRCLDA
Ga0207689_1182856013300025942Miscanthus RhizosphereMKTVLATATLTIMFLSAGAFAGNDTHTAPVAKSQITNVTVIAKNGQWPVKGQISLDACSVRRCLDA
Ga0207668_1013987323300025972Switchgrass RhizosphereMKTVLATATLTIMFLSAGAFAGNDTHTAPVAKSQITNVTVIAKNGQWPVKGQISLDACLVRRCLDA
Ga0209152_1039129613300026325SoilMKTLIATATLTIMFLSAGAFAANDIQMATVAKSSISNVTVITKNGQWPMKGQTSLDACSVRRCLDA
Ga0209582_126869013300027724Activated SludgeMKTLIATATLTIMFLSVGAFAGNDIKMASGAKPQVSNVTVILKNGQWPVKGQTSFDACSVRRCLDA
Ga0209262_1039755523300027841FreshwaterMKTLIATATLTIMFLSAGAFAGNDIRMATVAKPQVTNVTVILKNGQWPVKGQTSFDACSVRRCLDA
Ga0209254_1080062923300027897Freshwater Lake SedimentMKTLIATATLTVMFLSAGAFAGNDTRTATVAKPQVTNVTVIVKNGQWPVKGQISFDACALRRCLDA
Ga0209477_109182213300027959Activated SludgeHKMKTLIATATLTIMFLSAGAFAGNDIKMASGAKPQVSNVTVILKNGQWPVKGQTSFDACSVRRCLDA
Ga0308193_104067123300031096SoilMKTLIATATLTIMFLSVGAFAGNDIQMATVAKSQISNVTVITKNGQWPVKGQTSFDACSVRRCLDA
Ga0307501_1025502013300031152SoilTLIATATLTIMFLSAGAFAGNDLQMATLAKSQISNVTVITKNGQWPMKGQTSLDACSVRRCLDA
Ga0307408_10175356513300031548RhizosphereMKTLIATATLTIMFLSAGAFAGNDSKMETVAKSPISNVTVITKNGQWPVKGQTSFDACSVRRCLDA
Ga0307516_1008261933300031730EctomycorrhizaMKTLIATTTLTIMFLSAGAFAGNDIQMATVAKSQISNVTVITKNGQWPVKGQTSFDACSIRRCLDA
Ga0307405_1019418633300031731RhizosphereMKTLIATATLTIMFLSAGAFAGNDMPMATLAKSPISNVTVITKNGQWPVKGQTSFDACSVRRCLDA
Ga0315290_1026378433300031834SedimentMSPKMKTLIATATLTIMFLSAGAFAGSDRNITQVAQTPISNITIITKNSQWPVATQISRDACNLRRCIAI
Ga0307412_1068113823300031911RhizosphereMKTLIATATLTVMFLSAGAFAGNDMTAAITAKSQISNVTVIAKNGHWPVKGQISFDACSVRRCLDA
Ga0315278_1088084123300031997SedimentMSPKMKTLIATATLTIMFLSAGAFAGSDRNITQVAQTPISNITIITKSSQWPVATQISRDACNLRRCIAI
Ga0307416_10109887933300032002RhizosphereLIATATLTIMFLSAGAFAGNDTKMETIAKSPISNVTVIIKNGQWPVKGQTSLDACSVRRCLDA
Ga0310902_1033608013300032012SoilRWGNLFLTLKHRLWRRHKMKTLIATATLTIMFLSAGAFAGNDTKMETVAKSPISNVTVIIKNGQWPVKGQTSFDACSVRRCLDA
Ga0315292_1001464033300032143SedimentMSPKMKTLITTATLTIMFLSAGAFAGSDRNITQVAQTPISNVTIITKNSQWPVATQISRDACNLRRCIAI
Ga0315287_1005840323300032397SedimentMKTLIATATLTIMFLSAGAFAGSDRNITQVAQTPISNITIITKNSQWPVATQISRDACNLRRCIAI
Ga0315275_1260008213300032401SedimentMSPKMKTLIATATLTIMFLSAGAFAGSDRNITQVAQTPISNITIITKNSQWPVATQISRDACNLRRCI
Ga0335397_1004813133300032420FreshwaterMKTLIATATLTIMFLSAGAFAGNDTHMATVAKAPISNVTVITKNGQWPVKGQTSFDACSVRRCLDA
Ga0364930_0091525_126_3263300033814SedimentMKTVIATATLAVMFLSAGAFAGNDTQTASVAKSQITNVTVISKNGQWPVKGQISFDACSLRRCLDA
Ga0370486_191664_343_5073300034126Untreated Peat SoilMFLSAGAFAGSDAQMATVAKSQISNVTVITKNGQWPVKGQTSFDACSVRRCLDA
Ga0370489_0047951_433_6453300034127Untreated Peat SoilMRLKMKTLIATATLTIMFLSAGAFAGSDTHSSQTVANPVVNVTVISKNSQWPVVGQMTTDACSIRRCIAI
Ga0370498_048851_229_4293300034155Untreated Peat SoilMKTVIATATLTIMFLSAGAFAGNDTRTAPVAKSEITNVTVIIKNGQWPVKGQISVDACSLRRCMDA
Ga0364934_0063705_439_6813300034178SedimentLFLTLNTMSLEETKMKTVIATATLAVMFLSAGAFAGNDTQTAPVAKSQITNVTVISKNGQWPVKGQISFDACSLRRCLDA
Ga0370499_0019500_371_5713300034194Untreated Peat SoilMKTLIATATLTIMFLSAGAFAGNDIQMATVAKPQVTNVTVIIKNGQWPVKGQTSFDACSVRRCLDA
Ga0370545_020037_382_5823300034643SoilMKTLLATATLTIMFLSAGAFAGNNTQTAPMAKSQITNVTVIAKNGQWPVKGQISLDACSVRRCLDA
Ga0370545_088031_1_1953300034643SoilTLIATATLTIMFLSVGAFAGNDTQMATVAKSQISNVTVITKNGQWPVKGQTSFDACSVRRCLDA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.