Basic Information | |
---|---|
Family ID | F100059 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 103 |
Average Sequence Length | 43 residues |
Representative Sequence | MKNSFFPIIILFEKAVKEIQHGPKRKFVAKNYVHGNFFYGSKS |
Number of Associated Samples | 91 |
Number of Associated Scaffolds | 103 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 45.63 % |
% of genes near scaffold ends (potentially truncated) | 69.90 % |
% of genes from short scaffolds (< 2000 bps) | 96.12 % |
Associated GOLD sequencing projects | 88 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.36 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (67.961 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh (13.592 % of family members) |
Environment Ontology (ENVO) | Unclassified (66.019 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (83.495 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.54% β-sheet: 0.00% Coil/Unstructured: 77.46% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 103 Family Scaffolds |
---|---|---|
PF00355 | Rieske | 37.86 |
PF00848 | Ring_hydroxyl_A | 23.30 |
PF02219 | MTHFR | 6.80 |
PF01571 | GCV_T | 5.83 |
PF08669 | GCV_T_C | 1.94 |
PF13671 | AAA_33 | 0.97 |
PF13238 | AAA_18 | 0.97 |
PF08433 | KTI12 | 0.97 |
COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
---|---|---|---|
COG4638 | Phenylpropionate dioxygenase or related ring-hydroxylating dioxygenase, large terminal subunit | Inorganic ion transport and metabolism [P] | 46.60 |
COG0685 | 5,10-methylenetetrahydrofolate reductase | Amino acid transport and metabolism [E] | 6.80 |
COG4088 | tRNA uridine 5-carbamoylmethylation protein Kti12 (Killer toxin insensitivity protein) | Translation, ribosomal structure and biogenesis [J] | 0.97 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 67.96 % |
All Organisms | root | All Organisms | 32.04 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2166559013|NCBI_BBAY_READ_1105787249877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 949 | Open in IMG/M |
2189573027|GS312G0146KB_1114011670999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 949 | Open in IMG/M |
2189573027|GS312G0146KB_1118463101529 | Not Available | 770 | Open in IMG/M |
3300000213|LP_F_10_SI03_150DRAFT_c1010773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1948 | Open in IMG/M |
3300000226|SI34jun09_135mDRAFT_1031484 | Not Available | 1342 | Open in IMG/M |
3300000254|SI34jun09_100mDRAFT_1023640 | Not Available | 1318 | Open in IMG/M |
3300000254|SI34jun09_100mDRAFT_1034621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 947 | Open in IMG/M |
3300001346|JGI20151J14362_10183169 | Not Available | 590 | Open in IMG/M |
3300001943|GOS2226_1027371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1935 | Open in IMG/M |
3300003478|JGI26238J51125_1107757 | Not Available | 523 | Open in IMG/M |
3300003498|JGI26239J51126_1027239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1233 | Open in IMG/M |
3300003596|JGI26255J51710_1009737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2456 | Open in IMG/M |
3300003618|JGI26381J51731_1035813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1220 | Open in IMG/M |
3300003619|JGI26380J51729_10043003 | Not Available | 1192 | Open in IMG/M |
3300003619|JGI26380J51729_10095550 | Not Available | 669 | Open in IMG/M |
3300005430|Ga0066849_10367988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 544 | Open in IMG/M |
3300006025|Ga0075474_10134982 | Not Available | 780 | Open in IMG/M |
3300007637|Ga0102906_1116110 | Not Available | 737 | Open in IMG/M |
3300008012|Ga0075480_10617149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 512 | Open in IMG/M |
3300008950|Ga0102891_1050567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1290 | Open in IMG/M |
3300009000|Ga0102960_1211036 | Not Available | 691 | Open in IMG/M |
3300009001|Ga0102963_1182888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 839 | Open in IMG/M |
3300009003|Ga0102813_1107278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 888 | Open in IMG/M |
3300009052|Ga0102886_1146819 | Not Available | 705 | Open in IMG/M |
3300009079|Ga0102814_10782065 | Not Available | 527 | Open in IMG/M |
3300009193|Ga0115551_1331829 | Not Available | 661 | Open in IMG/M |
3300009193|Ga0115551_1362227 | Not Available | 627 | Open in IMG/M |
3300009434|Ga0115562_1304392 | Not Available | 545 | Open in IMG/M |
3300009437|Ga0115556_1037541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2085 | Open in IMG/M |
3300009440|Ga0115561_1194197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 775 | Open in IMG/M |
3300009476|Ga0115555_1245052 | Not Available | 729 | Open in IMG/M |
3300009498|Ga0115568_10161475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1059 | Open in IMG/M |
3300009508|Ga0115567_10877942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 533 | Open in IMG/M |
3300009593|Ga0115011_11257310 | Not Available | 641 | Open in IMG/M |
3300009593|Ga0115011_11754145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 558 | Open in IMG/M |
3300009703|Ga0114933_10173584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1472 | Open in IMG/M |
3300010385|Ga0136809_1111002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1340 | Open in IMG/M |
3300012920|Ga0160423_10376722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 972 | Open in IMG/M |
3300012936|Ga0163109_10546123 | Not Available | 849 | Open in IMG/M |
3300012954|Ga0163111_10518977 | Not Available | 1101 | Open in IMG/M |
3300012954|Ga0163111_10746870 | Not Available | 927 | Open in IMG/M |
3300012954|Ga0163111_12166618 | Not Available | 562 | Open in IMG/M |
3300016771|Ga0182082_1262124 | Not Available | 746 | Open in IMG/M |
3300017717|Ga0181404_1028610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1430 | Open in IMG/M |
3300017730|Ga0181417_1096460 | Not Available | 715 | Open in IMG/M |
3300017741|Ga0181421_1043656 | Not Available | 1198 | Open in IMG/M |
3300017762|Ga0181422_1249868 | Not Available | 525 | Open in IMG/M |
3300017762|Ga0181422_1255833 | Not Available | 517 | Open in IMG/M |
3300017781|Ga0181423_1086973 | Not Available | 1231 | Open in IMG/M |
3300017783|Ga0181379_1195571 | Not Available | 709 | Open in IMG/M |
3300017786|Ga0181424_10197716 | Not Available | 852 | Open in IMG/M |
3300017818|Ga0181565_10433311 | Not Available | 863 | Open in IMG/M |
3300017824|Ga0181552_10435524 | Not Available | 624 | Open in IMG/M |
3300017958|Ga0181582_10474927 | Not Available | 783 | Open in IMG/M |
3300018049|Ga0181572_10539365 | Not Available | 715 | Open in IMG/M |
3300018416|Ga0181553_10760595 | Not Available | 503 | Open in IMG/M |
3300018876|Ga0181564_10305627 | Not Available | 886 | Open in IMG/M |
3300020053|Ga0181595_10263141 | Not Available | 723 | Open in IMG/M |
3300020053|Ga0181595_10263146 | Not Available | 723 | Open in IMG/M |
3300020177|Ga0181596_10321350 | Not Available | 614 | Open in IMG/M |
3300020191|Ga0181604_10454922 | Not Available | 538 | Open in IMG/M |
3300020421|Ga0211653_10501169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 517 | Open in IMG/M |
3300020459|Ga0211514_10143433 | Not Available | 1185 | Open in IMG/M |
3300020459|Ga0211514_10532333 | Not Available | 577 | Open in IMG/M |
3300020463|Ga0211676_10074630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2308 | Open in IMG/M |
3300021085|Ga0206677_10211939 | Not Available | 822 | Open in IMG/M |
3300021085|Ga0206677_10283101 | Not Available | 670 | Open in IMG/M |
3300021087|Ga0206683_10116338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1449 | Open in IMG/M |
3300021087|Ga0206683_10131833 | Not Available | 1345 | Open in IMG/M |
3300021089|Ga0206679_10711895 | Not Available | 503 | Open in IMG/M |
3300021368|Ga0213860_10138255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1071 | Open in IMG/M |
3300021957|Ga0222717_10166270 | Not Available | 1331 | Open in IMG/M |
(restricted) 3300022888|Ga0233428_1277278 | Not Available | 523 | Open in IMG/M |
3300022907|Ga0255775_1040705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2417 | Open in IMG/M |
3300022928|Ga0255758_10180521 | Not Available | 1003 | Open in IMG/M |
3300024235|Ga0228665_1058330 | Not Available | 796 | Open in IMG/M |
(restricted) 3300024243|Ga0233436_1039009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1905 | Open in IMG/M |
(restricted) 3300024252|Ga0233435_1168521 | Not Available | 655 | Open in IMG/M |
(restricted) 3300024260|Ga0233441_1049936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1629 | Open in IMG/M |
(restricted) 3300024261|Ga0233439_10385397 | Not Available | 578 | Open in IMG/M |
(restricted) 3300024324|Ga0233443_1202210 | Not Available | 696 | Open in IMG/M |
3300024329|Ga0228631_1136983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 547 | Open in IMG/M |
3300025659|Ga0209249_1037355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1817 | Open in IMG/M |
3300025666|Ga0209601_1122484 | Not Available | 749 | Open in IMG/M |
3300025680|Ga0209306_1098085 | Not Available | 874 | Open in IMG/M |
3300025705|Ga0209374_1087211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 985 | Open in IMG/M |
3300025870|Ga0209666_1103875 | Not Available | 1375 | Open in IMG/M |
3300025894|Ga0209335_10405423 | Not Available | 547 | Open in IMG/M |
3300026130|Ga0209961_1082439 | Not Available | 569 | Open in IMG/M |
3300026183|Ga0209932_1035775 | Not Available | 1241 | Open in IMG/M |
3300026483|Ga0228620_1045933 | Not Available | 1003 | Open in IMG/M |
3300027207|Ga0208946_1071760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1055 | Open in IMG/M |
3300027253|Ga0208680_1036084 | Not Available | 951 | Open in IMG/M |
3300027315|Ga0208949_1059018 | Not Available | 691 | Open in IMG/M |
3300028115|Ga0233450_10167839 | Not Available | 1064 | Open in IMG/M |
3300028173|Ga0257118_1047747 | Not Available | 1085 | Open in IMG/M |
3300028175|Ga0257117_1038784 | Not Available | 1350 | Open in IMG/M |
3300028287|Ga0257126_1189242 | Not Available | 650 | Open in IMG/M |
3300028391|Ga0233394_1090503 | Not Available | 649 | Open in IMG/M |
3300031773|Ga0315332_10744477 | Not Available | 599 | Open in IMG/M |
3300031851|Ga0315320_10830474 | Not Available | 576 | Open in IMG/M |
3300032011|Ga0315316_11619498 | Not Available | 505 | Open in IMG/M |
3300032088|Ga0315321_10678434 | Not Available | 600 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 13.59% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 13.59% |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 9.71% |
Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 8.74% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 7.77% |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 5.83% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 5.83% |
Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 4.85% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 4.85% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 4.85% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 2.91% |
Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 2.91% |
Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 2.91% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.94% |
Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine | 1.94% |
Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.94% |
Environmental And Host-Associated | Environmental → Aquatic → Marine → Oceanic → Unclassified → Environmental And Host-Associated | 0.97% |
Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.97% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.97% |
Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.97% |
Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 0.97% |
Marine Brown Algae (Kelp) Associated | Host-Associated → Algae → Brown Algae → Unclassified → Unclassified → Marine Brown Algae (Kelp) Associated | 0.97% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2166559013 | Marine microbial communities from the Atlantic Ocean, for comparison studies - Ocean1 (Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY01 3688) | Environmental | Open in IMG/M |
2189573027 | Estuarine microbial communities from Columbia River, sample from CR-7km from mouth, GS312-FOS-0p8-CR7-chlmax | Environmental | Open in IMG/M |
3300000213 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_F_10_SI03_150 | Environmental | Open in IMG/M |
3300000226 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 135m | Environmental | Open in IMG/M |
3300000254 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 100m | Environmental | Open in IMG/M |
3300001346 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 | Environmental | Open in IMG/M |
3300001943 | Marine microbial communities from Cape May, New Jersey, USA - GS010 | Environmental | Open in IMG/M |
3300003478 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_100m_DNA | Environmental | Open in IMG/M |
3300003498 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_130m_DNA | Environmental | Open in IMG/M |
3300003596 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI073_LV_135m_DNA | Environmental | Open in IMG/M |
3300003618 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_165m_DNA | Environmental | Open in IMG/M |
3300003619 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_165m_DNA | Environmental | Open in IMG/M |
3300005430 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69 | Environmental | Open in IMG/M |
3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
3300007637 | Estuarine microbial communities from the Columbia River estuary - metaG 1556A-02 | Environmental | Open in IMG/M |
3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
3300008950 | Estuarine microbial communities from the Columbia River estuary - metaG 1552A-02 | Environmental | Open in IMG/M |
3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
3300009003 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725 | Environmental | Open in IMG/M |
3300009052 | Estuarine microbial communities from the Columbia River estuary - metaG 1550A-02 | Environmental | Open in IMG/M |
3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
3300009434 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 | Environmental | Open in IMG/M |
3300009437 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 | Environmental | Open in IMG/M |
3300009440 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512 | Environmental | Open in IMG/M |
3300009476 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 | Environmental | Open in IMG/M |
3300009498 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 | Environmental | Open in IMG/M |
3300009508 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 | Environmental | Open in IMG/M |
3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
3300010385 | Giant kelp blades associated microbial communities from the kelp forest near Monterey Bay Aquarium, California, USA . Combined Assembly of Gp0155292, Gp0155293 | Host-Associated | Open in IMG/M |
3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
3300016771 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071412BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
3300017730 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13 | Environmental | Open in IMG/M |
3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017958 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018049 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018876 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300020053 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041401AS metaG (spades assembly) | Environmental | Open in IMG/M |
3300020177 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041402US metaG (spades assembly) | Environmental | Open in IMG/M |
3300020191 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041410US metaG (spades assembly) | Environmental | Open in IMG/M |
3300020421 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007) | Environmental | Open in IMG/M |
3300020459 | Marine microbial communities from Tara Oceans - TARA_X000000368 (ERX555913-ERR599095) | Environmental | Open in IMG/M |
3300020463 | Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050) | Environmental | Open in IMG/M |
3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
3300021087 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 | Environmental | Open in IMG/M |
3300021089 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 | Environmental | Open in IMG/M |
3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
3300022888 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_120_MG | Environmental | Open in IMG/M |
3300022907 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG | Environmental | Open in IMG/M |
3300022928 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG | Environmental | Open in IMG/M |
3300024235 | Seawater microbial communities from Monterey Bay, California, United States - 79D | Environmental | Open in IMG/M |
3300024243 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_150_MG | Environmental | Open in IMG/M |
3300024252 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_135_MG | Environmental | Open in IMG/M |
3300024260 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_135_MG | Environmental | Open in IMG/M |
3300024261 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_100_MG | Environmental | Open in IMG/M |
3300024324 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_200_MG | Environmental | Open in IMG/M |
3300024329 | Seawater microbial communities from Monterey Bay, California, United States - 39D | Environmental | Open in IMG/M |
3300025659 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_200m_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025666 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 (SPAdes) | Environmental | Open in IMG/M |
3300025680 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 (SPAdes) | Environmental | Open in IMG/M |
3300025705 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10m (SPAdes) | Environmental | Open in IMG/M |
3300025870 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025894 | Pelagic Microbial community sample from North Sea - COGITO 998_met_09 (SPAdes) | Environmental | Open in IMG/M |
3300026130 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
3300026183 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
3300026483 | Seawater microbial communities from Monterey Bay, California, United States - 23D | Environmental | Open in IMG/M |
3300027207 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C49A8_80 (SPAdes) | Environmental | Open in IMG/M |
3300027253 | Estuarine microbial communities from the Columbia River estuary - metaG 1556A-02 (SPAdes) | Environmental | Open in IMG/M |
3300027315 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_03_M0_10 (SPAdes) | Environmental | Open in IMG/M |
3300028115 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501CT (spades assembly) | Environmental | Open in IMG/M |
3300028173 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_150m | Environmental | Open in IMG/M |
3300028175 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_135m | Environmental | Open in IMG/M |
3300028287 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI060_120m | Environmental | Open in IMG/M |
3300028391 | Seawater microbial communities from Monterey Bay, California, United States - 24D | Environmental | Open in IMG/M |
3300031773 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 34915 | Environmental | Open in IMG/M |
3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
3300032088 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ocean1-_00044070 | 2166559013 | Environmental And Host-Associated | MKNSFFPIIILFEKAVKEIQHCSKWKFVAKNYAHDNFFYGSKSEK |
GS312G0146KB_00233380 | 2189573027 | Marine Estuarine | MKNSFFPIIILFEKAVKEIQHGPKWKLVAKNYAHDNFFYGSKSEK |
GS312G0146KB_00326490 | 2189573027 | Marine Estuarine | SFFPIIILFEKAVKEIQHGPKWKFIAKNYGHGNFFYGPKS |
LP_F_10_SI03_150DRAFT_10107733 | 3300000213 | Marine | MKNSFFPIIILFEKAVKEIQHGPKRKFVAKNYVRDKF |
SI34jun09_135mDRAFT_10314841 | 3300000226 | Marine | VDQFPMKNSFFPIIILFEKAVKEIQHGPKRKFVAKNYVRXNFFYGPKS* |
SI34jun09_100mDRAFT_10236401 | 3300000254 | Marine | KNSFFPIIILFEKAVKEIQHGPKRKFVAKNYVRDNFFYGPKS* |
SI34jun09_100mDRAFT_10346212 | 3300000254 | Marine | MKNSFFPIIILFEKAVKEIQHGPKRKFVAKNYVVVIFFHGPKP* |
JGI20151J14362_101831691 | 3300001346 | Pelagic Marine | MKNSFFPIIILFEKAVKEIQHGLKWKFVAKNYVHDNF |
GOS2226_10273715 | 3300001943 | Marine | FPIIILFEKAVKEIQHVPKWKFVAKNHGHGNFFYGSKS* |
JGI26238J51125_11077571 | 3300003478 | Marine | MKNSFFPIIILFEKAVKEIQHGPKRKFVAKNYVRGNFFYGPKS* |
JGI26239J51126_10272392 | 3300003498 | Marine | MKNSFFPIIILFEKAVKEIQHGPKRKFVAKNYVRXNFFYGPKS* |
JGI26255J51710_10097374 | 3300003596 | Marine | MKNSFFPIIILFEKAVKEIQHGPKRKFVAKNYVRDNFFYGPKS* |
JGI26381J51731_10358131 | 3300003618 | Marine | FPMKNSFFPIIILFEKAVKEIQHGPKRKFVAKNYVRGNFFYGPKS* |
JGI26380J51729_100430031 | 3300003619 | Marine | GQYVDQFPMKNSFFPIIILFEKAVKEIQHGPKRKFVAKNYVRGNFFYGPKS* |
JGI26380J51729_100955501 | 3300003619 | Marine | NSFFPIIILFEKAVKEIQHGPKRKFVAKNYVRGNFFYGPKS* |
Ga0066849_103679882 | 3300005430 | Marine | MKNSFFPIIILFEKAVKEIQHGPKRKFVAKNYVHGNFFYGSKS* |
Ga0075474_101349821 | 3300006025 | Aqueous | MKNSFFQIIILFEKAVKEIQHGSKWKFVAKNYVHDIFFCGSKSEK* |
Ga0102906_11161101 | 3300007637 | Estuarine | MKNSFFPIIILFEKAVKEIQHGSKRKFVAKNYVRGNFFYGPKS* |
Ga0075480_106171492 | 3300008012 | Aqueous | MKNSFFQIIILFEKAVKEIQHGLKWKFVAKNYVRDIFFCGSKSEK* |
Ga0102891_10505672 | 3300008950 | Estuarine | MKSSFFPIIILFEKAVKEIHHGLKWKFVAKNFGHGNFFRGSKSEK* |
Ga0102960_12110361 | 3300009000 | Pond Water | IHFFSIIILLEKAVKEIQHGSKRKFVAKNFGHDIFFCGSKSEK* |
Ga0102963_11828882 | 3300009001 | Pond Water | MKNSFFQIIILFEKAVKEIQHVLKWKFVAKNYVHDIFFCGSKSEK* |
Ga0102813_11072782 | 3300009003 | Estuarine | MKNSFFPIIILFEKAVKEIQHGPKWKFIAKNYGHDNFFYGPKS* |
Ga0102886_11468192 | 3300009052 | Estuarine | VKFLGQCVDQFPMKNSFFPIIILFEKAVKEIQHGSKRKFVAKNYVRDNFFYGPKS* |
Ga0102814_107820651 | 3300009079 | Estuarine | MFQGQYVDQFLMKNSFFPIIILFEKAVKEIQHGPKWKFIAKNYGHGNFFYGPKS* |
Ga0115551_13318292 | 3300009193 | Pelagic Marine | MKNSFFQIIILFEKAVKEIQHGPKLKFVAKNYAHDNFFYGSKSEK* |
Ga0115551_13622271 | 3300009193 | Pelagic Marine | MKSSFFPIIILFEKAVKEIQHGLKWKFVAKNYVHDNFFVVQNQKY |
Ga0115562_13043922 | 3300009434 | Pelagic Marine | FPIIILFEKAVKEIQHGLKWKFVAKNYVRDIFFCGSKSEK* |
Ga0115556_10375411 | 3300009437 | Pelagic Marine | IIILFEKAVKEIQHAQNRNFVAKNYGHGNFFYGPKS* |
Ga0115561_11941972 | 3300009440 | Pelagic Marine | MKNSFFQIIILFEKAVKEIQHGSKWKFVAKNYVRDIFFCGSKSEK* |
Ga0115555_12450522 | 3300009476 | Pelagic Marine | PMKNSFFQIIILFEKAVKEIQHVLKWKFVAKNYVRDIFFCGSKSEK* |
Ga0115568_101614752 | 3300009498 | Pelagic Marine | MKNSFFPIIILFEKAVKEIQHAQNRNFVAKNYGHGNFFYGPKS* |
Ga0115567_108779422 | 3300009508 | Pelagic Marine | MKNSFFPIIILFEKAVKEIQHGPKWKFVAKNYAHDNFFYGSKSEK* |
Ga0115011_112573101 | 3300009593 | Marine | IHFFQIIILFEKAVKEIQHSYKWKIVAKNYVHGNFFYGSKP* |
Ga0115011_117541452 | 3300009593 | Marine | MKNSFFPIIILFEKAVKEIQHSPKWKFVAKNFAHGNFLYGAKS* |
Ga0114933_101735841 | 3300009703 | Deep Subsurface | QIIIFFKKAVKEIQQEPLTKFVAKNHAHDIFLCGPKS* |
Ga0136809_11110023 | 3300010385 | Marine Brown Algae (Kelp) Associated | MKNSFFPIIILFEKAVKEIQNGPKWKFIAKNYGHGNFFYGPKS* |
Ga0160423_103767222 | 3300012920 | Surface Seawater | MKNSFFQIIILFEKAVKEIQHGLKWKFVAKNYVHDNFFCGSKSEK* |
Ga0163109_105461231 | 3300012936 | Surface Seawater | IIILFKKAVKEIQHGSNLKFVAKNYLRDNFFCGSKSEK* |
Ga0163111_105189771 | 3300012954 | Surface Seawater | IILFEKAVKEIQHSPKWKFVAKNFAHGNFLYGAKS* |
Ga0163111_107468702 | 3300012954 | Surface Seawater | QIIILFEKAVKEIQHGPKWKFVAKNCAHDNFFYGSKSEK* |
Ga0163111_121666181 | 3300012954 | Surface Seawater | VKNSFFQIIIFFKKAVKEIQQGSKLKFVAKNYVHGNFFCGSK* |
Ga0182082_12621241 | 3300016771 | Salt Marsh | MKNSFFQIIILFEKAVKEIQHGSKWKFVAKNYVRDIF |
Ga0181404_10286103 | 3300017717 | Seawater | DEEDEKFIFFLMIILFVKAVKEIQQCPKRKFVAKNFDHGNFFCGSKS |
Ga0181417_10964602 | 3300017730 | Seawater | MIILFVKAVKEIQQDPRAKFVAKNDVRGNFFCGPKS |
Ga0181421_10436562 | 3300017741 | Seawater | IIFYEKAVKEIQQLTQTIIVAKNGAHDNFFCGPKLQK |
Ga0181422_12498682 | 3300017762 | Seawater | SEKFIFQIIILFVKAVKEIQQDPKWKFVAKNCGHGNFFCGPKS |
Ga0181422_12558332 | 3300017762 | Seawater | PMKNSFFPIIILFEKAVKEIQHGPKWKFIAKNYGHGNFFYGPKS |
Ga0181423_10869732 | 3300017781 | Seawater | LQEVKFLGQCVDQFPMKNSFFPIIILFEKAVKEIQHGPKWKFVAKYYGHGNFFYGPKS |
Ga0181379_11955712 | 3300017783 | Seawater | MKNSFFSIIILFEKAVKEIQHSEIGKFVAKNYVHGNFFYGPKS |
Ga0181424_101977162 | 3300017786 | Seawater | LKKSSFFLIIILFEKAVKEIQQLLKAKFVAKKYAHDNFFCGPKS |
Ga0181565_104333112 | 3300017818 | Salt Marsh | MKNSFFQIIILFKKAVKEIQHSSNWKFVAKKHGHDNFFYAPKSEK |
Ga0181552_104355242 | 3300017824 | Salt Marsh | KIHFFQIIIFFKKAVKEIQQGSKLKIVAKNYVHGNFFYGSK |
Ga0181582_104749272 | 3300017958 | Salt Marsh | MKNSFFQIIILFEKAVKEIQHGSKWKFVAKNYVRD |
Ga0181572_105393651 | 3300018049 | Salt Marsh | FPMKNSFFQIIILFEKAVKEIQHGSKWKFVAKNYAHDIFFCGSKSEK |
Ga0181553_107605952 | 3300018416 | Salt Marsh | MKNSFFQIIILFEKAVKEIQHGPKWKFVAKNYVRD |
Ga0181564_103056271 | 3300018876 | Salt Marsh | HPLQKAVFRGQSWDQFPMKNSFFQIIILFEKAVKEIQHVLKWKFVAKNYVHDIFFCGSKSEK |
Ga0181595_102631412 | 3300020053 | Salt Marsh | MKNSFFQIIILFEKAVKEIQHGSKWKFVAKNYVRDIFFCGSKSEK |
Ga0181595_102631462 | 3300020053 | Salt Marsh | MKNSFFQIIILFEKAVKEIQHGSKWKFVAKNYVHDIFFCGSKSEK |
Ga0181596_103213501 | 3300020177 | Salt Marsh | IIILFEKAVKEIQHGSKWKFVAKNYVHDIFFCGSKSEK |
Ga0181604_104549222 | 3300020191 | Salt Marsh | IIFFKKAVKEIQQGSKLKIVAKNYVHDNFFCGSKYEK |
Ga0211653_105011692 | 3300020421 | Marine | MKNSFFPIIILFEKAVKEIQHSPKWKFVAKNFAHGNFLYGAKS |
Ga0211514_101434332 | 3300020459 | Marine | KFIIFLIIILFQKAVKEIQQGSKLKIVAKKYVHGNFFCGPKYEK |
Ga0211514_105323332 | 3300020459 | Marine | KIHFFPIIILFEKAVKEIQHVPKWKFVAKNYGHGNFFYGQKS |
Ga0211676_100746304 | 3300020463 | Marine | VKNSFFQIIILFVKAVKEIQHKSKSKFVAKNDAHVNFFCGPKLQK |
Ga0206677_102119392 | 3300021085 | Seawater | FPIIILFEKAVKEIQHGPKWKFVAKNYAHDNFFYGSKSEK |
Ga0206677_102831012 | 3300021085 | Seawater | MKNSFFPIIILFEKAVKEIQHGPKRKFVAKNYVRGNFFYGP |
Ga0206683_101163383 | 3300021087 | Seawater | MKNSFFPIIILFEKAVKEIQHGSKRKFVAKNYVRG |
Ga0206683_101318332 | 3300021087 | Seawater | QYVDQFLMKNSFFPIIILFEKAVKEIQHGSKRKFVAKNYVRDNFFYGPKS |
Ga0206679_107118952 | 3300021089 | Seawater | PISKEKFIFQIIILFENAVKEIQQELQTKFVAKNNAHDNFFCGSKS |
Ga0213860_101382552 | 3300021368 | Seawater | MKNSFFQIIILFKKAVKEIQHSSNWKFVAKKHGHDNFFYGPKSEK |
Ga0222717_101662702 | 3300021957 | Estuarine Water | HFFPIIILFEKAVKEIQHGPKWKFIAKNYGHGNFFYEPKS |
(restricted) Ga0233428_12772781 | 3300022888 | Seawater | MKNSFFPIIILFEKAVKEIQHGPKRKFVAKNYVRDKFFYGPKS |
Ga0255775_10407051 | 3300022907 | Salt Marsh | MKNSFFQIIILFKKAVKEIQHSSNWKFVAKKHGHDNFFL |
Ga0255758_101805211 | 3300022928 | Salt Marsh | SMWTNFQRKIHFFQIIIFFKKAVKEIQQGSKLKIVAKNYVHGNFFYGSK |
Ga0228665_10583301 | 3300024235 | Seawater | KNSFFPIIILFEKAVKEIQHGPKWKFVAKNCAHDNFFYGSKSEK |
(restricted) Ga0233436_10390093 | 3300024243 | Seawater | MKNSFFPIIILFEKAVKEIQHGPKWKFVAKNYVRGN |
(restricted) Ga0233435_11685212 | 3300024252 | Seawater | MKNSFFPIIILFEKAVKEIQHGPKRKFVAKNYVRGNFF |
(restricted) Ga0233441_10499361 | 3300024260 | Seawater | MKNSFFPIIILFEKAVKEIQHGPKRKFVAKNYVRGNFFYG |
(restricted) Ga0233439_103853971 | 3300024261 | Seawater | LGPISSEKFIFFLMIILFVKAVKEIQQGPKWKFVAKNCGHGNFFCEPKS |
(restricted) Ga0233443_12022102 | 3300024324 | Seawater | HPLQKAMFQGQYVDQFLMKNSFFPIIILFEKAVKEIQHGPKRKFVAKNYVRDNFFYGPKS |
Ga0228631_11369832 | 3300024329 | Seawater | MKNSFFPIIILFEKAVKEIQHGPKWKFVAKNYDRVNFFYGPKS |
Ga0209249_10373553 | 3300025659 | Marine | MKNSFFPIIILFEKAVKEIQHGPKRKFVAKNYVRGN |
Ga0209601_11224841 | 3300025666 | Pelagic Marine | IILFEKAVKEIQQLLKAKFVAKKYAHDNFFCGSKS |
Ga0209306_10980852 | 3300025680 | Pelagic Marine | SFFLIIILFEKAVKEIQQLLKAKFVAKKYAHDNFFCGPKS |
Ga0209374_10872113 | 3300025705 | Marine | MKSSFFPIIILFEKAVKEIHHGLKWKFVAKNYVHDNFFWC |
Ga0209666_11038753 | 3300025870 | Marine | LLMIILFVKAVKEIQQGPKWKFVAKNCGHGNFFCGPKS |
Ga0209335_104054232 | 3300025894 | Pelagic Marine | MKSSFFPIIILFEKAVKEIQHGLKWKFVAKNYVHD |
Ga0209961_10824391 | 3300026130 | Water | ISIEKFIFFSIIILFEKAVKEIQHGSKRKFVAKNYGHDIFFCGSKSEK |
Ga0209932_10357752 | 3300026183 | Pond Water | QFPMKNSFFQIIILFEKAVKEIQHGSKWKFVAKNYVHDIFFYGSKSEK |
Ga0228620_10459331 | 3300026483 | Seawater | KIHFFPIIILFKKAVKEIHLVEKKFIAKNYTHDNFF |
Ga0208946_10717603 | 3300027207 | Marine | MKNSFFPIIILFEKAVKEIQHGPKRKFVAKNYVHGNFFYGSKS |
Ga0208680_10360841 | 3300027253 | Estuarine | AMFQGQYVDQFLMKNSFFPIIILFEKAVKEIQHGSKRKFVAKNYVRGNFFYGPKS |
Ga0208949_10590182 | 3300027315 | Marine | QGLCEDQFPMKNSFFPIIILFEKAVKEIQHGPKWKFIAKNYGHGNFFYGPKS |
Ga0233450_101678391 | 3300028115 | Salt Marsh | FPMKNSFFQIIILFKKAVKEIQHSSNWKFVAKKHGHDNFFYGPKSEK |
Ga0257118_10477473 | 3300028173 | Marine | MKNSFFPIIILFEKAVKEIQHGPKRKFVAKNYVRGNFFYGPKS |
Ga0257117_10387841 | 3300028175 | Marine | QYVDQFLMKNSFFPIIILFEKAVKEIQHGPKRKFVAKNYVRDNFFYGPKS |
Ga0257126_11892422 | 3300028287 | Marine | FFPIIILFEKAVKEIQHGPKRKFVAKNYVRDNFFYGPKS |
Ga0233394_10905031 | 3300028391 | Seawater | PIIILFEKAVKEIQHGPKWKFVAKNYAHDNFFYGSKSEK |
Ga0315332_107444771 | 3300031773 | Seawater | GQCVDQFPMKNSFFPIIILFEKAVKEIQHGPKRKFVAKNYVRGNFFYGPKS |
Ga0315320_108304742 | 3300031851 | Seawater | MKNSFFPIIILFEKAVKEIQHGPKWKFVAKNYVHGNFFCGSKS |
Ga0315316_116194982 | 3300032011 | Seawater | GPISKEKFIFQIIILFENAVKEIQQELQTKFVAKNNAHDNFFCGSKS |
Ga0315321_106784341 | 3300032088 | Seawater | FPIIILFEKAVKEIQHGSKWKFVAKNYAHDNFFYGSKSEK |
⦗Top⦘ |