NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F098287

Metagenome Family F098287

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F098287
Family Type Metagenome
Number of Sequences 104
Average Sequence Length 118 residues
Representative Sequence RPEIVIIHTLGGEKLDHEGSAYMMYLAFKQAMDRKVPVGKLWMTVNGWLLDETAQKNGKGKPDVKIDVKDYLKTKYEALNKHVSQNGGFGRDYVTNNQTQPKEVIEEFITVIDNTKK
Number of Associated Samples 86
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 91.35 %
% of genes from short scaffolds (< 2000 bps) 87.50 %
Associated GOLD sequencing projects 77
AlphaFold2 3D model prediction Yes
3D model pTM-score0.63

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.115 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil
(19.231 % of family members)
Environment Ontology (ENVO) Unclassified
(27.885 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(25.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 34.48%    β-sheet: 19.31%    Coil/Unstructured: 46.21%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.63
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF01436NHL 37.50
PF02585PIG-L 16.35
PF17170DUF5128 5.77
PF16656Pur_ac_phosph_N 1.92
PF13715CarbopepD_reg_2 0.96
PF14294DUF4372 0.96
PF0563523S_rRNA_IVP 0.96
PF01609DDE_Tnp_1 0.96
PF14871GHL6 0.96
PF01799Fer2_2 0.96
PF01042Ribonuc_L-PSP 0.96
PF00141peroxidase 0.96
PF06739SBBP 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG2120N-acetylglucosaminyl deacetylase, LmbE familyCarbohydrate transport and metabolism [G] 16.35
COG0251Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 familyDefense mechanisms [V] 0.96
COG0376Catalase (peroxidase I)Inorganic ion transport and metabolism [P] 0.96
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.96
COG3293TransposaseMobilome: prophages, transposons [X] 0.96
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.96
COG5421TransposaseMobilome: prophages, transposons [X] 0.96
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.96
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.96

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.12 %
UnclassifiedrootN/A2.88 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2228664021|ICCgaii200_c1066098All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes699Open in IMG/M
3300001213|JGIcombinedJ13530_105234691All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes559Open in IMG/M
3300001213|JGIcombinedJ13530_106887484All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes702Open in IMG/M
3300001373|YBMDRAFT_10308269All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1074Open in IMG/M
3300002961|JGI11641J44799_10192113All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → unclassified Bacteroides → Bacteroides sp.573Open in IMG/M
3300003992|Ga0055470_10089354All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes745Open in IMG/M
3300003996|Ga0055467_10128954All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes742Open in IMG/M
3300004006|Ga0055453_10186097All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes647Open in IMG/M
3300004155|Ga0066600_10613226All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes544Open in IMG/M
3300004157|Ga0062590_100712462All Organisms → cellular organisms → Bacteria906Open in IMG/M
3300004242|Ga0066601_10015222All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2336Open in IMG/M
3300004282|Ga0066599_100428875All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → unclassified Bacteroides → Bacteroides sp.833Open in IMG/M
3300004282|Ga0066599_100632735All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes723Open in IMG/M
3300004463|Ga0063356_100599199All Organisms → cellular organisms → Bacteria1488Open in IMG/M
3300005545|Ga0070695_101419089All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300005612|Ga0070723_10252294All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes820Open in IMG/M
3300006880|Ga0075429_100199880All Organisms → cellular organisms → Bacteria1751Open in IMG/M
3300009029|Ga0066793_10348952All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes852Open in IMG/M
3300009034|Ga0115863_1230436All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → unclassified Bacteroides → Bacteroides sp.2213Open in IMG/M
3300009039|Ga0105152_10240982All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → unclassified Bacteroides → Bacteroides sp.747Open in IMG/M
3300009060|Ga0102962_1071782All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes977Open in IMG/M
3300009081|Ga0105098_10103655All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1231Open in IMG/M
3300009085|Ga0105103_10910439All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes516Open in IMG/M
3300009086|Ga0102812_10606827All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes600Open in IMG/M
3300009111|Ga0115026_10721837All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → unclassified Bacteroides → Bacteroides sp.771Open in IMG/M
3300009111|Ga0115026_11061151All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → unclassified Bacteroides → Bacteroides sp.651Open in IMG/M
3300009131|Ga0115027_10139498All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1466Open in IMG/M
3300009131|Ga0115027_11466652All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes558Open in IMG/M
3300009146|Ga0105091_10113498All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1250Open in IMG/M
3300009167|Ga0113563_11121747All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes912Open in IMG/M
3300009167|Ga0113563_11588130All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → unclassified Bacteroides → Bacteroides sp.773Open in IMG/M
3300009168|Ga0105104_10030365All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3048Open in IMG/M
3300009169|Ga0105097_10122482All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1426Open in IMG/M
3300009179|Ga0115028_10613809All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes815Open in IMG/M
3300009179|Ga0115028_11702424All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → unclassified Bacteroides → Bacteroides sp.544Open in IMG/M
3300009506|Ga0118657_10187106All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2899Open in IMG/M
3300009509|Ga0123573_12200025All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes501Open in IMG/M
3300010373|Ga0134128_12436801All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes577Open in IMG/M
3300010413|Ga0136851_11219394All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes728Open in IMG/M
3300012892|Ga0157294_10167231All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes624Open in IMG/M
3300012898|Ga0157293_10030559All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1081Open in IMG/M
3300012906|Ga0157295_10051952All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes979Open in IMG/M
3300012907|Ga0157283_10246778All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes590Open in IMG/M
3300012931|Ga0153915_12403814All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes616Open in IMG/M
3300012964|Ga0153916_10140336All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides2346Open in IMG/M
3300012964|Ga0153916_11914046All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes664Open in IMG/M
3300012964|Ga0153916_12811489All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes549Open in IMG/M
(restricted) 3300013127|Ga0172365_10344561All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → unclassified Bacteroides → Bacteroides sp.879Open in IMG/M
3300013297|Ga0157378_10432476All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1303Open in IMG/M
3300013308|Ga0157375_11265524All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes867Open in IMG/M
3300013869|Ga0181468_103446All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1850Open in IMG/M
3300014300|Ga0075321_1078545All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → unclassified Bacteroides → Bacteroides sp.634Open in IMG/M
3300014311|Ga0075322_1075030All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes765Open in IMG/M
3300015200|Ga0173480_10142855All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1214Open in IMG/M
3300015200|Ga0173480_10393005All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes803Open in IMG/M
3300018081|Ga0184625_10136252All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1280Open in IMG/M
3300018081|Ga0184625_10449053All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes660Open in IMG/M
3300019356|Ga0173481_10236114All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes815Open in IMG/M
3300022550|Ga0212127_10214954All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes583Open in IMG/M
3300022756|Ga0222622_11214328All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes555Open in IMG/M
3300022880|Ga0247792_1069313All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes687Open in IMG/M
3300022886|Ga0247746_1222080All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes501Open in IMG/M
3300024056|Ga0124853_1259269All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1638Open in IMG/M
3300025888|Ga0209540_10046778All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → unclassified Bacteroides → Bacteroides sp.2670Open in IMG/M
3300026066|Ga0208290_1005944All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → unclassified Bacteroides → Bacteroides sp.1125Open in IMG/M
3300027715|Ga0208665_10191126All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes644Open in IMG/M
3300027743|Ga0209593_10210313All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → unclassified Bacteroides → Bacteroides sp.683Open in IMG/M
3300027800|Ga0209800_10025078All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3034Open in IMG/M
3300027871|Ga0209397_10630737All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → unclassified Bacteroides → Bacteroides sp.537Open in IMG/M
3300027876|Ga0209974_10242287All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes676Open in IMG/M
3300027877|Ga0209293_10479027All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → unclassified Bacteroides → Bacteroides sp.651Open in IMG/M
3300027887|Ga0208980_10071071All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia2032Open in IMG/M
3300027890|Ga0209496_10728014All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → unclassified Bacteroides → Bacteroides sp.544Open in IMG/M
3300027917|Ga0209536_100914678All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1083Open in IMG/M
3300027972|Ga0209079_10108545All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes948Open in IMG/M
3300027993|Ga0247749_1006054All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1114Open in IMG/M
3300031274|Ga0307442_1075302All Organisms → cellular organisms → Bacteria1011Open in IMG/M
3300031731|Ga0307405_10079542All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2137Open in IMG/M
3300032143|Ga0315292_10985108All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → unclassified Bacteroides → Bacteroides sp.701Open in IMG/M
3300033408|Ga0316605_10510249All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1109Open in IMG/M
3300033413|Ga0316603_10537689All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1077Open in IMG/M
3300033414|Ga0316619_11653356All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes577Open in IMG/M
3300033418|Ga0316625_102479450All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes524Open in IMG/M
3300033419|Ga0316601_101013826All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → unclassified Bacteroides → Bacteroides sp.829Open in IMG/M
3300033433|Ga0326726_10110569All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → unclassified Bacteroides → Bacteroides sp.2470Open in IMG/M
3300033481|Ga0316600_10644488All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes742Open in IMG/M
3300033483|Ga0316629_11794695All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes507Open in IMG/M
3300033485|Ga0316626_11501334All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → unclassified Bacteroides → Bacteroides sp.607Open in IMG/M
3300033486|Ga0316624_10706508All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → unclassified Bacteroides → Bacteroides sp.888Open in IMG/M
3300033486|Ga0316624_11022510All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes746Open in IMG/M
3300033513|Ga0316628_104198558All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes513Open in IMG/M
3300033521|Ga0316616_100559052All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1331Open in IMG/M
3300033521|Ga0316616_100658516All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1244Open in IMG/M
3300033521|Ga0316616_102301695All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes719Open in IMG/M
3300033521|Ga0316616_102624053All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → unclassified Bacteroides → Bacteroides sp.677Open in IMG/M
3300033521|Ga0316616_103514602All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes590Open in IMG/M
3300033557|Ga0316617_100700760All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes956Open in IMG/M
3300033557|Ga0316617_102105811All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes581Open in IMG/M
3300033557|Ga0316617_102476909All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes538Open in IMG/M
3300034155|Ga0370498_106350All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → unclassified Bacteroides → Bacteroides sp.656Open in IMG/M
3300034169|Ga0370480_0035568All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1740Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil19.23%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland8.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.69%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment6.73%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater4.81%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands3.85%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland3.85%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands2.88%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands2.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.88%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands2.88%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.92%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.92%
Mangrove SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment1.92%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.92%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.92%
Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment0.96%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment0.96%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment0.96%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.96%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.96%
Marine EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine0.96%
Sediment, IntertidalEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Sediment, Intertidal0.96%
Mangrove SedimentEnvironmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment0.96%
Hot Spring SedimentEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring Sediment0.96%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.96%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.96%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.96%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.96%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface0.96%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.96%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.96%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.96%
Clean RoomEngineered → Built Environment → Unclassified → Unclassified → Unclassified → Clean Room0.96%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2228664021Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300001373YB-Mouth-sedEnvironmentalOpen in IMG/M
3300002961Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A1 BulkEnvironmentalOpen in IMG/M
3300003992Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D1EnvironmentalOpen in IMG/M
3300003996Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2EnvironmentalOpen in IMG/M
3300004006Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2EnvironmentalOpen in IMG/M
3300004155Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004242Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Medium cellulose week 11EnvironmentalOpen in IMG/M
3300004282Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sedimentEnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005612Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2EnvironmentalOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009034Intertidal mud flat sediment archaeal communities from Garolim Bay, Chungcheongnam-do, KoreaEnvironmentalOpen in IMG/M
3300009039Lake sediment microbial communities from Lake Baikal, Russia to study Microbial Dark Matter (Phase II) - Lake Baikal sediment 0-5 cmEnvironmentalOpen in IMG/M
3300009060Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_D2_MGEnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009085Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009086Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713EnvironmentalOpen in IMG/M
3300009111Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1EnvironmentalOpen in IMG/M
3300009131Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1EnvironmentalOpen in IMG/M
3300009146Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009169Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300009179Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1EnvironmentalOpen in IMG/M
3300009506Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8EnvironmentalOpen in IMG/M
3300009509Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010413Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_9EnvironmentalOpen in IMG/M
3300012892Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1EnvironmentalOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012964Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaGEnvironmentalOpen in IMG/M
3300013127 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cmEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300013869Clean room microbial communities from NASA Spacecraft Assembly Facility at Jet Propulsion Laboratory, Pasadena, California, USA - InSight In1 SAF170 SPAdes reassemblyEngineeredOpen in IMG/M
3300014300Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D1EnvironmentalOpen in IMG/M
3300014311Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1EnvironmentalOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300022550Zodletone_combined assemblyEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022880Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6EnvironmentalOpen in IMG/M
3300022886Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5EnvironmentalOpen in IMG/M
3300024056Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300025888Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes)EnvironmentalOpen in IMG/M
3300026066Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027715Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC (SPAdes)EnvironmentalOpen in IMG/M
3300027743Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027800Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 8 (SPAdes)EnvironmentalOpen in IMG/M
3300027871Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027876Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027877Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027887Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 BulkEnvironmentalOpen in IMG/M
3300027890Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027917Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)EnvironmentalOpen in IMG/M
3300027972Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027993Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S199-509C-5EnvironmentalOpen in IMG/M
3300031274Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-30EnvironmentalOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300032143Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0EnvironmentalOpen in IMG/M
3300033408Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCTEnvironmentalOpen in IMG/M
3300033413Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCTEnvironmentalOpen in IMG/M
3300033414Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_BEnvironmentalOpen in IMG/M
3300033418Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_AEnvironmentalOpen in IMG/M
3300033419Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCTEnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033481Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CTEnvironmentalOpen in IMG/M
3300033483Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_AEnvironmentalOpen in IMG/M
3300033485Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_AEnvironmentalOpen in IMG/M
3300033486Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_AEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300033557Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_BEnvironmentalOpen in IMG/M
3300034155Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_17EnvironmentalOpen in IMG/M
3300034169Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
ICCgaii200_106609822228664021SoilMDHGNTGYMMYLAFKKAIAQKVPVGKLWVTVNGWLLDKDAQRNGRGKPDVHINVKDYLKTKYTALNKHISQNGGFGRDYVTGNLTQPKEVIEEFITILDNTK
JGIcombinedJ13530_10523469113300001213WetlandGTAYMMYLAFKKAKEKHIPVGKLWMTVNGWLLDEEAQKRGRGKPDIQVNVKDYLKTKYEALNKHVSQNGGFGRDYVRENKTQPLEVVEEFITVLDYTK*
JGIcombinedJ13530_10688748423300001213WetlandRPEIVIIHTLGGEKLDHEGSAYMMYLAFKQAMDRKVPVGKLWMTVNGWLLDETAQKNGKGKPDVKIDVKDYLKTKYEALNKHVSQNGGFGRDYVTNNQTQPKEVIEEFITVIDNTKK*
YBMDRAFT_1030826913300001373Marine EstuarineHEGTAYMMYLAFVEAMDKNIPVGQLWMPVNGWLLDKDAQRNGRGKPDVKVDVRDYLKTKYEALNKHISQNGGFGRDYVTDNETQPKEVIEEFITVIDNMK*
JGI11641J44799_1019211313300002961WetlandFVNFNPPGRRQISLATRYSEDVDIVVDLLKNYQPEIVITHTLGGEKLDHEGTAYMMYLAFKKAKEXNIPLGKLWMTANGWLLDEVAQKSGRGKPDIRVDVKDFLKIKYEALNKHVSQNGGFGRDYVIENKTQPLEIVEEFITVLDYTK*
Ga0055470_1008935423300003992Natural And Restored WetlandsEKYQPEIVITHTLGGEKLDHEGTAYMMYLAFKRAMANNIPVGKLWMTVNGWLLDGTSQKNGRGKPDIHINVKDFLKTKYEALDKHVSQNGGYGRDYVIQGKIQPKEVIEEFITVIDNSR*
Ga0055467_1012895413300003996Natural And Restored WetlandsDVDVVYELLEKYQPGIVITHTLGGEKLDHEGTAYMMYLAFKRAMANNIPVGKLWMTVNGWLLDGTSQKNGRGKPDIHINVKDFLKTKYEALDKHVSQNGGYGRDYVIQGKIQPKEVIEEFITVIDNSR*
Ga0055453_1018609713300004006Natural And Restored WetlandsMYLAFKKAMEKGIPIGKLWMDVDGWMKDKPAQASGRGKPDIHIDVRDYLHIKYEALNKHVSQNGGFGRQYVTDNQTQPKEVIEEFITVIDNAKYPIEKNKTKK*
Ga0066600_1061322613300004155FreshwaterQPEIVIIHTLGGEKLDHEGAAYMMYLAFKKAVDNKVPVGKLWMTVNGWLVDYPSNKNGRGKPDVKIDVRDYLKTKYEALNKHVSQNGGLGREYVMDDGDQPKEVVEEFITVVDNTKY*
Ga0062590_10071246213300004157SoilGNTGYLIYLAFKKAMETNVPVGKLWMVVNGWLLDKTAQQNGRGKPDVHIDVKEYLNTKYTALNKHISQNGGFGRDYVTGNETQPKEKIEEFITVIDNTKK*
Ga0066601_1001522233300004242FreshwaterFLDYDAPGRRQINLATRYSADVNVVYEMLKKYQPEIVIIHTLGGEKLDHEGAAYMMYLAFKKAIDNKIPVGKLWMTVNGWLLDYPSNKNGRGKPDVRIDVRDYLKTKYEALDKHVSQNGGFGREYVMDDGDQPKEVIEEFITVVDNTR*
Ga0066599_10042887523300004282FreshwaterVIIYASEDFIRYNPPGRRQISLATRYSEDVNVVVDLLKKYQPEIVITHTLGGEKLDHEGTAYMMYLAFKKAADNNIPVGKLWMTVNGWLLDKEAVRKGRGKADIQVDVRDYLKIKYEALNKHVSQNGGFGREYVMDNKTQPKEVIEEFITVLDNTKQ*
Ga0066599_10063273523300004282FreshwaterIPVGKLWMTVNGWLLDKEAQRRGRSKPDVQIDVRDYLKTKYEALNKHVSQNGGYGRDYVMDNKTQPKELTEEFITVFDYTK*
Ga0063356_10059919913300004463Arabidopsis Thaliana RhizosphereAVVFELLKKYKPEIVITHTMGGEKLDHGNAGYLVYLAFKKARDENIPVGKLWMVVNGWLLDAPALKNGRRKADVQVDVKEFLEQKYEAINKHISQNGGFARDYVTGNKTQPKEIVEEFITVMDNTN*
Ga0070695_10141908923300005545Corn, Switchgrass And Miscanthus RhizosphereLLIKYKPDIIITHTLGGEKMDHGNVAYMIYLAAKKAMEKNVFKGKLWMSVNGWFLDGVAQKNGKGKPDVRIDVKDYLKTKYTALNKHISQNGGLGREYVIENEVHPKEVVEEFITVLDNTK*
Ga0070723_1025229423300005612Marine SedimentIALVVDLLRKYQPEIVITHTLGGEKHDHGNGAYLMYLAFKDAMDQNIPVGKLWMTVNGWLLDQEAQDSGRGDPDVQIEVSDYLKTKYEALNKHVSQNGGFGRAYVTKNETQPKEVIEEFITVIDNTK*
Ga0075429_10019988013300006880Populus RhizosphereIDKNLFKGKLWMSVNGWFLDPVAQKNGKGKPDVRIDVKDFLKIKYTALNKHISQNGGLGREYVIENEVHPKEGVEEFITVLDNTR*
Ga0066793_1034895223300009029Prmafrost SoilAYMMYLAFKEAMNKNIPVGKLWMTVNGWLLDKDAQSNDRGKPDVRIDVKDYLKTKYEALNKHISQNGGFGRDYVTENETQPKEVIEEFITVIDNTR*
Ga0115863_123043623300009034Sediment, IntertidalMGEPNAFRKAIERDVPVGKLWMTVNGWLLDKDAQANGRGVPDVHIEVEDYLSTKYEALNKHVSQNGGFGRDYVIRNKTQPKEVIEEFITVIDNTK*
Ga0105152_1024098223300009039Lake SedimentPPGRRQINLATRYSEDVDVVVNLLKQYQPEIVITHTLGGEKLDHEGTAYMMYLAFKRAMDKNIPVGKFWMTVNGWLLDKDAQKNGRGKPDVQVNVKDYLKIKYEALNKHLSQNGGFGRDYVMDNKTQPREVIEEFITVLDNTKY*
Ga0102962_107178213300009060SoilTREFIDYNPPSRKHISLATRYSEDVAVVTNLLKKYEPEIVITHTLGGEKLDHEGTAYMVYLAFMRAIRDEVPVGKLWMTVNGWLLDREARESGRGKPDVTIDISDYLAVKYGALDQHLSQNGGFGRDYIVINKGKVNENIEEFITVADNTK*
Ga0105098_1010365513300009081Freshwater SedimentKEQKIPVGKLWMNINGWLLEKPAIKKGRGKPDVQIDVKDYLKTKYEALNMHVSQNGGFGKDYAMNTERQPREVIEEFIKVIDYTK*
Ga0105103_1091043923300009085Freshwater SedimentKLWMTVNGWLLDYPAKINGKGKPDIQVDVKNFLKTKYEALDKHVSQNGGNGREYVMNNKVQPKEVIEEFITVIDNTK*
Ga0102812_1060682713300009086EstuarineTDLLRKYQPEIVIIHTLGGEKHDHANGAYLMYQAFTKAIDEGIPVGKLWMTVNGWLLDKYSEEDCRGIPDVHIEVEKYLDTKYEALNKHVSQNGGYGRDYVMGNETQPKEVIEEFISVIDNTK*
Ga0115026_1072183723300009111WetlandRYSSDVNVVFELLKKYKPEIVIIHTLGGEKLDHEGSAYMMYLAFKRAMDRNIPVGKLWMTVSGWLLDNPAQSNGKGKPDIHIYVKDFLKTKYEALNMHVSQNGGHGKEYVMNNKVQPKEIIEEFITVIDNTK*
Ga0115026_1106115113300009111WetlandKLDHEGSAYMMYLAFKKAMDRNIPVGKLWMYIDGWLLDKTAQENGRGKPDVRIDVRDHLNTKYEALNKHVSQNGGFGRQYVIDNETQPKEKIEEFITVIDNTK*
Ga0115027_1013949813300009131WetlandIVITHTLGGEKLDHEGTAYMVYLAFKKAMSNDVPVGKLWMTVNGWLLDQTSVKNGRGRPDVRIDVRNYLSTKYEALNKHVSQNGGFGRDYVIQNETQPKEVVEEFITVIDNTKK*
Ga0115027_1146665213300009131WetlandMRIPVGKLWMRPKGWLVENPPKAKGRGKPDVRIDVKDYLKTKYEALNKHVSQNGGFGRAYVMDDGDQPKEVIEEFMTVLDN
Ga0105091_1011349823300009146Freshwater SedimentYDPPGRRQINLATRYSADVNLVFEMLKKYQPEIVIIHTLGGEKLDHEGAAYMMYLAFKKAIDNKVPVGKLWMTVNGWLLDFPNNKNGRGNPDIKIDVKDFLKKKYEALNKHISQNGGFGREYVMDDGDQPKEVIEEFITVIDNTK*
Ga0113563_1112174713300009167Freshwater WetlandsTAYMVYLAFKKAMNNNVPVGKLWMTVNGWLLDKTSFKNGRGRPDVRIDVRDYLSTKYEALNKHVSQNGGFGRDYVIQNETQPKEVVEEFITVIDNTKK*
Ga0113563_1158813023300009167Freshwater WetlandsKLIIYATEDFMNYNPPGRRQINLATRYSEDVDVVVDLLKKYQPEIVITHTLGGEKLDHEGTAYMMYLAFTRAMDKNIPVGKLWMTVNGWLLDKDAQRNGRGKPDIHIDVKDYLKTKYEALNKHISQNGGFGREYVTENETQPKEVTEEFITVLDNTLSK*
Ga0105104_1003036513300009168Freshwater SedimentEIVIIHTLGGEKLDHEGSAYMMYLAFKKAIDRNIPVGKLWMTVNGWLLDYPAKINGKGKPDIQVDVKNFLKTKYEALDKHVSQNGGNGREYVMNNKVQPKEVIEEFITVIDNTK*
Ga0105097_1012248213300009169Freshwater SedimentIILTHTLGGEKLDHEGTAYMIYLAFKKAKEQKIPVGKLWMNINGWLLEKPAIKKGRGKPDVQIDVKDYLKTKYEALNMHVSQNGGFGKDYAMNTERQPREVIEEFIKVIDYTK*
Ga0115028_1061380913300009179WetlandSAYMMYLAFKKAMDRNIPVGKLWMTVNGWLLDYPAKTNGKGKPDICIDVKDFLKTKYEALNKHVSQNGGNGRAYVMNNKVQPGEVTEEFITVIDNTK*
Ga0115028_1170242423300009179WetlandKKAMDKNVAVGKLWMTVNGWLLDDEAQRNGRGKPDVRINVSDFLTLKYEALDKHISQNGGFGRDYVIKNQTQPLEVIEEFICVIDNTK*
Ga0118657_1018710643300009506Mangrove SedimentITHTLGGEKHDHGNGAYLMYLAFKKAIDGGIPVGKLWMTVNGWLLDQYSQENGRGVPDIQVEVTDFLNVKYEALNKHVSQNGGYGRDYVTKNETQPREVVEEFITVIENPNNRTD*
Ga0123573_1220002513300009509Mangrove SedimentHTLGGEKHDHGNGAYLMYLAFEKAMEENIPVGKLWMTVNGWLLRRMSQENGRGVPDVHIDVEDYLDTKYEALNKHMSQNGGYGREYVMSNRVQPKELVEEFITVIDNTGSD*
Ga0134128_1243680123300010373Terrestrial SoilMYLAFKKAIDQKVPVGKLWVPVNGWLLDKDAQKNGRGKPDVHINVKDHLKTKYKALNKHISQNGGFGRDYVMGNLTQPKEVIEEFITILDNTK*
Ga0136851_1121939423300010413Mangrove SedimentNIPVGKLWMTVNGWLLNKDAQESGRGLPDVHIDVKDYLDTKYEALNKHVSQNGGFGRDYVMGNKTQPKEVIEEFITVIDHSK*
Ga0157294_1016723113300012892SoilPLIPIATYMDSEVDFVYELLKKYQPEIVITHTMGGEKMDHGNTGYLVYLAFKKAMDTNVPVGKLLMVVNGWLLDKTAQQNGRGKPDVRIDVKEYLNTKYTALNKHISQNGGFGRDYVTGNETQPKEKIEEFITVIDNTKK*
Ga0157293_1003055913300012898SoilELLKKYQPEIVITHTMGGEKMDHGNTGYLVYLAFKKAMDTNVPVGKLLMVVNGWLLDKTAQQNGRGKPDVHIDVKEYLNTKYTALNKHISQNGGFGRDYVTGNETQPKEKIEEFITVIDNTKK*
Ga0157295_1005195223300012906SoilYQPEIVITHTMGGEKMDHGNTGYLIYLAFKKAMETNVPVGKLWMVVNGWLLDKTAQQNGRGKPDVHIDVKEYLNTKYTALNKHISQNGGFGRDYVTGNETQPKEKIEEFITVIDNTKK*
Ga0157283_1024677823300012907SoilLKKYQPEIVITHTMGGEKMDHGNTGYLIYLAFKKAMETNVPVGKLWMVVNGWLLDKTAQQNGRGKPDVHIDVKEYLNTKYTALNKHISQNGGFGRDYVTGNETQPKEKIEEFITVIDNTKK*
Ga0157297_1002850023300012914SoilVYYGEPAYDAFDPPGRPLIPIATYMDSEVDFVYELLKKYQPEIVITHTMGGEKMDHGNTGYLIYLAFKKAMETNVPVGKLWMVVNGWLLDKTAQQNGRGKPDVHIDVKEYLNTKYTALNKHISQNGGFGRDYVTGNETQPKEKIEEFITVIDNTKK*
Ga0153915_1240381413300012931Freshwater WetlandsGGDKLDHEGSAYMMYLAFKKAMDRNIPVGKLWMVVDVGGWLNDKLAQITGRGKPDVHIDVKDYLPTKYEALNKHISQNGGFGRQYVTDNKTQPKEKIEEFITVIDNTKNDKRKDH*
Ga0153916_1014033613300012964Freshwater WetlandsIYATEDFMNYNPPGRRQINLATRYSEDVDVVVDLLKKYQPEIVITHTLGGEKLDHEGTAYMMYLAFTRAMDKNIPVGKLWMTVNGWLLDKDAQRNGRGKPDVHIDVKDYLKTKYEALNKHISQNGGFGRAYVTENETQPKEVIEEFITVLDNTLSK*
Ga0153916_1191404623300012964Freshwater WetlandsKKAIDNNVPVGKLWMTVNGWLLDYPAAKNGRGKPDVHVYVKDFLKTKYEALNKHISQNGGFGRDYVLKNKTQPKEVTEDFITVIDNTK*
Ga0153916_1281148913300012964Freshwater WetlandsNIPVGKLWMVVDVGGWLNDKLAQITGRGKPDVHIDVKDYLPTKYEALNKHISQNGGFGRQYVTDNKTQPKEKIEEFITVIDNTKNDKRKDH*
(restricted) Ga0172365_1034456123300013127SedimentAYLVYLAFKEAMEDNVPVGKLWMTVNGWLLDKDAQNNGRGIPDVHIDVKDYLGTKYEALNKHVSQNGGFGRDYLIRNETQPKEDIEEFITVIDNTK*
Ga0157378_1043247613300013297Miscanthus RhizosphereNNVPVGKFWMVVNGWFLDKTAQQNGRGKPDVHIDVKNYLTTKYAALNKHVSQNGGFGRDYVTGNETQPREVIEDFITVIENTK*
Ga0157372_1193428923300013307Corn RhizosphereAYLIYLAFKRVMKEKVPVGKLWMAVRGWLSEKGAQENGRGKADVVVDVKDFLKIKYAAYDKHVSQNGGFGRDYVTGNKTQPKEIIEEFITVIDNTK*
Ga0157375_1126552413300013308Miscanthus RhizosphereKKAMETNVPVGKLWMVVNGWLLDKTAQQNGRGKPDVHIDVKEYLNTKYTALNKHISQNGGFGRDYVTGNETQPKEKIEEFITVIDNTKK*
Ga0181468_10344633300013869Clean RoomMEQNIPVGKLWMVVNGWLLDKTAQQNGRGKPDVHIDVKDYINTKYKALNKHVSQNGGFGRDYVTGNKTQPKEIIEEFITVIDNTR*
Ga0075321_107854513300014300Natural And Restored WetlandsRKIIIYGTQDFLNYNPPGRRQINLATRYSEDVNVVYELLKKYEPEIVIIHTLGGEKLDHEGSAYMMYLAFKIAMDNKIPVGKLWMTINGWLLDGTAQKNGRGKADIHIDVKDYLHIKYAALDKHVSQNGGSGRQYVLENETQPKEKIEEFITVIDNTK*
Ga0075322_107503013300014311Natural And Restored WetlandsRPGIVITHTLGGEKLDHEGTAYMMYLAFKKAIENGIPVGKLWMTVNGWLQDKPSERNGRGKPDVHVDVRDYLEVKYEALNKHISQNGGSGRDYVMDNKTQPKEVVEEFITILDNTK*
Ga0173480_1014285513300015200SoilTNVPVGKLWMVVNGWLLDKTAQQNGRGKPDVHIDVKEYLNTKYTALNKHISQNGGFGRDYVTGNETQPKEKIEEFITVIDNTKK*
Ga0173480_1039300513300015200SoilKKYQPEIVITHTMGGEKMDHGNTGYLVYLAFKKAMDTNVPVGKLLMVVNGWLLDKTAQQNGRGKPDVRIDVKEYLNTKYTALNKHISQNGGFGRDYVTGNETQPKEKIEEFITVIDNTKK
Ga0184625_1013625213300018081Groundwater SedimentELLKKYQPEIVITHTLGGEKHDHGNAGYMMYLAFKKAIQQKIPVGKLWMTVNGWVADKDAQKNGRGKPDIRINVRDFLKIKYSAYDKHVSQNGGFGRDYVMRNKKQSKEDLEEFITVLDTTK
Ga0184625_1044905323300018081Groundwater SedimentMGGEKMDHGNTGYLVYLAFKKAMDTNVPVGKLLMVVNGWLLDKTAQQNGRGKPDVHIDVKEYLNTKYTALNKHISQNGGFGRDYVTGNETQPKEKIEEFITVIDNTKK
Ga0173481_1023611413300019356SoilKMDHGNTGYLIYLAFKKAMETNVPVGKLWMVVNGWLLDKTAQQNGRGKPDVHIDVKEYLNTKYTALNKHISQNGGFGRDYVTGNETQPKEKIEEFITVIDNTKK
Ga0212127_1021495413300022550Hot Spring SedimentFIAFNPPGRKHISLATRYSEDVGVVTDLLKKYRPEIVITHTLGGEKLDHEGTAYMVYLAFKRAIQDEVPVGRLWMTVNGWLLEREAMESGRGKPDVSIDVSDYLAVKYRALDQHRSQNGGFGRDYIVINKGKVNEDIEEFITVVDNTK
Ga0222622_1121432823300022756Groundwater SedimentTYMDTEVDFVYELLKKYQPEIVITHTMGGEKMDHGNTGYLVYLAFKKAMDTNVPVGKLLMVVNGWLLDKTAQQNGRGKPDVRIDVKEYLNTKYTALNKHISQNGGFGRDYVTGNETQPKEKIEEFITVIDNTKK
Ga0247792_106931313300022880SoilEVDFVYELLKKYQPEIVITHTMGGEKMDHGNTGYLIYLAFKKAMETNVPVGKLWMVVNGWLLDKTAQQNGRGKPDVHIDVKEYLNTKYTALNKHISQNGGFGRDYVTGNETQPKEKIEEFITVIDNTKK
Ga0247746_122208013300022886SoilRPLIPIATYMDSEVDFVYELLKKYQPEIVITHTMGGEKMDHGNTGYLIYLAFKKAMETNVPVGKLWMVVNGWLLDKTAQQNGRGKPDVHIDVKEYLNTKYTALNKHISQNGGFGRDYVTGNETQPKEKIEEFITVIDNTKK
Ga0124853_125926933300024056Freshwater WetlandsIVIIHTLGGDKLDHEGSAYMMYLAFKKAMDRNIPVGKLWMVVDTDGWLNDDIARKTGRGRPDIHLDVKDFLKVKYEALNKHVSQNGGRGREYVTENKTQAKEKTEEFITVLDNTKK
Ga0209540_1004677843300025888Arctic Peat SoilYDEDVEVVYNLFKKYRPEIVITHTLGGEKLDHEGTAYMTYLAFKEAMNKGIPVGKLWMPVNGWFLDKEAQRTGRGKPDIHENVKDYLKIKYEALNKHVSQNGGFGREYVTGNETQPKESIEEFITVIDNTK
Ga0208290_100594423300026066Natural And Restored WetlandsLLRKYRPEIVITHTLGGEKLDHEGTAYMMYLAFKEAIENGIPVGKLWMTVNGWLQDKPSGRNGRGKPDVHVDVRDFLMVKYEALNKHVSQNGGSGRDYVMDNQTQPKEVIEEFITVLDNT
Ga0208665_1019112623300027715Deep SubsurfaceYSDDVNLVYELLKQYEPEIVITHTLGGEKLDHEGTAYMVYLAFKKAVNNNVPVGKLWMTVNGWLLDTPAQENGRGKPDIHIDVRDYLKIKYEALNKHVSQNGGFGREYVSENETQPREVVEEFITVIDNTKLK
Ga0209593_1021031323300027743Freshwater SedimentDLVFELLKKYQPEIVITHTLGGEKLDHEGTAYLMYLAFVQAIDKGIHVGKLLMPVNGWLKDIPGSKNGKGKPDVRINVKNYLGRKYTALNKHLSQNGGFGRDYFMESHTPVKETFEEFITVVDNTP
Ga0209800_1002507843300027800FreshwaterVNVVYEMLKKYQPEIVIIHTLGGEKLDHEGAAYMMYLAFKKAVDNKIPVGKLWMVVNGWLLDYPSNKNGRGKPDVRIDVRDYLKTKYEALDKHVSQNGGFGREYVMDDGDQPKEVIEEFITVVDNTR
Ga0209397_1063073713300027871WetlandVVFELLKKYKPEIVIIHTLGGEKLDHEGSAYMMYLAFKRAMDRNIPVGKLWMTVNGWLLDNPAQSNGKGKPDIHIYVKDFLKTKYEALNMHVSQNGGFGREYVSENETQPREAVEEFITVIDNTKLK
Ga0209974_1024228723300027876Arabidopsis Thaliana RhizosphereVELLIKYKPDIIITHTLGGEKMDHGNVGYMIYLAMKKAMDKNLFKGKLWMSVNGWFLDPVAQKNGKGKPDVRIDVKDFLKTKYTALNKHISQNGGLGREYVIENEVHPKEGVEEFITVLDNTR
Ga0209293_1047902713300027877WetlandKLDHEGSAYMMYLAFKKAMDRNIPVGKLWMYIDGWLLDKTAQENGRGKPDVRIDVRDHLNTKYEALNKHISQNGGFGRQYVIDNETQPKEKIEEFITVIDNTK
Ga0208980_1007107113300027887WetlandRRQISLATRYSEDVDIVVDLLKNYQPEIVITHTLGGEKLDHEGTAYMMYLAFKKAKERNIPLGKLWMTANGWLLDEVAQKSGRGKPDIRVDVKDFLKIKYEALNKHVSQNGGFGRDYVIENKTQPLEIVEEFITVLDYTK
Ga0209496_1072801423300027890WetlandKKAMDKNVAVGKLWMTVNGWLLDDEAQRNGRGKPDVRINVSDFLTLKYEALDKHISQNGGFGRDYVIKNRTQPLEVIEEFICVIDNTK
Ga0209536_10091467823300027917Marine SedimentAFRKALYQKIPVGKLWMTVNGWLLDPEARAADRGRPDVQVEVSDYLKTKYEALDKHISQNGGFGRDYVVKNKGKVNENIEEFITVADNTK
Ga0209079_1010854523300027972Freshwater SedimentEKLDHEGAAYMMYLAFKKAIDNKVPVGKLWMTVNGWLLDFPNNKNGRGNPDIKIDVKDFLKKKYEALNKHISQNGGFGREYVMDDGDQPKEVIEEFITVIDNTK
Ga0247749_100605423300027993SoilDAFDPPGRPLIPIATYMDSEVDFVYELLKKYQPEIVITHTLGGEKMDHGNTGYLIYLAFKKAMETNVPVGKLWMVVNGWLLDKTAQQNGRGKPDVHIDVKEYLNTKYTALNKHISQNGGFGRDYVTGNETQPKEKIEEFITVIDNTKK
Ga0307442_107530213300031274Salt MarshLKKYEPEIVITHTLGGEKLDHEGTAYMVYLAFISAMRENAQVGKLWMTVNGWLLDKEARESGRGIPDVSIDISDYLDVKYMALDQHTSQNGGFGRDYIVINKGKINEDIEEFITVVDNSK
Ga0307405_1007954243300031731RhizosphereELLRKYKPEIVITHTMGGEKLDHGNSGYLMYVAFKKVMKEKIPVGKLWMVVNGWLLDEPALRTGRGKPDIEIDVKDYLDLKYAAINKHVSQNGGFGRDYVTGNKTQPREVTEEFITVIDNTK
Ga0315292_1098510823300032143SedimentLATRYDEDVDIVVDMLRKYQPEIVITHTLGGEKLDHEGTAYMMYLAFTEAMDKKIPVGKLWMPVNGWFLDKEAQRTGRGKPDIRIDVKNYLKTKYEALNKHISQNGGFGREYVTDNETQPLETIEEFITVIDNMK
Ga0316605_1051024923300033408SoilKQINLATRYSEDVNVVYDILKQYKPEIVITHTLGGEKLDHEGTAYMIYLAFKKAMDDKVPVGKLWMTVNGWLLDTTSQKNGRGKPDVHIDVRNHLKTKYEALDKHLSQNGGSGREYVIKNRTQPKEVIEEFITVIDNTK
Ga0316603_1053768923300033413SoilDHEGTAYMIYLAFKKAMDDKVPVGKLWMTVNGWLLDTTSQKNGRGKPDVHIDVRNHLKTKYEALDKHLSQNGGSGREYVIKNRTQPKEVIEEFITVIDNTK
Ga0316619_1165335623300033414SoilLLKKYQPEIVITHTLGGEKLDHEGTAYMMYLAFTKAIEHNVPVGKLWMTVNGWLLDDLAQKKGRGRPDIHIDVRDYLPTKYEALNKHISQNGGFGRKYVTDNETQPKEKIEEFIEVLDNTIKVKTNK
Ga0316625_10247945013300033418SoilKLDHEGTAYMVYLAFKKAMSNNVPVGKLWMTVNGWLLDKTSVKNGRGRPDVRIDVRNYLSTKYEALNKHVSQNGGFGRDYVIQNETQPKEVVEEFITVIDNTKK
Ga0316601_10101382613300033419SoilGTRDFIDYNPPGRRQINLATRYSEDVTVVFELLKKYQPEIVITHTLGGEKLDHEGTAYMMYLAFTKAIEHNVPVGKLWMTVNGWLLDDLAQKKGRGRPDIHIDVRDYLPTKYEALNKHISQNGGFGRKYVTDNETQPKEKIEEFIEVLDNTIKVKTNK
Ga0326726_1011056943300033433Peat SoilGLLKQYQPEIIIIHTLGGEKLDHGNSAYLMYLAYQRAISTGVAVGKLWMKVDGWLLDDVAQKTGRGKPDVQVDVKNYLPTKYEALNKHISQNGGYGRNYVIRNQTQPKEVIEEFITVGDAMH
Ga0316600_1064448823300033481SoilKQYKPEIVITHTLGGEKLDHEGTAYMIYLAFKKAMDNKVPVGKLWMTINGWLLDTTSQKNGRGKPDVHIDVRNHLKTKYEALDKHLSQNGGSGREYVIKNRTQPKEVIEEFITVIDNTK
Ga0316629_1179469513300033483SoilKLDHEGTAYMVYLAFKKAMNNNVPVGKLWMTVNGWLLDKTSVKNGRGKPDVRIDVRNYLNTKYEALNKHVSQNGGFGRDYVIQNETQPKEVVEEFITVIDNTKK
Ga0316626_1150133423300033485SoilVNVVFELLKKYKPEIVIIHTLGGEKLDHEGSAYMMYLAFKRAMDRNIPVGKLWMTVNGWLLDNPAQSNGKGKPDIHIYVKDFLKTKYEALNMHVSQNGGHGKEYVMNNKVQPKEIIEEFITVIDNTK
Ga0316624_1070650823300033486SoilKVIIYGTQDFLNYNPPGRKQINLATRYSEDVNVVYGLLKQYKPEIVITHTLGGEKLDHEGTAYMMYLAFKKAMDNNVPVGKLWMTVNGWLLDKTSRNNGRGKPDVHIDVRNHLKTKYEALNKHLSQNGGSGREYVIRNQTQPKEVIEEFITVIDNTK
Ga0316624_1102251013300033486SoilGGEKLDHEGTAYMMYLAFTKAIVHNVPVGKLWMTVNGWLLDDLAQKKGRGRPDIHIDVRDYLPTKYEALNKHISQNGGFGRKYVTDNETQPKEKIEEFIEVLDNTIKVKTNK
Ga0316628_10419855813300033513SoilFGAEAVFLDFREPEIWLGRKAMPYGTREFQDYDAPGGRFVNLATRYHADVARVVELLRKYQPEIVITHTLGGEKVDHGGCAYLMYLAFKEAMAKRIRVGKLWMSVNGWLAYTDAQKNGRGVPDVHVDVKDYLKTKFAALDKHVSQNGGFGQQYVRVREIQPKEVIEEFIT
Ga0316616_10055905213300033521SoilEPEIVITHTLGGEKLDHEGTAYLIYVAFEKARTRNIPVGKLWMTVNGWLLDEFSQKNGRGKPDVHIDVKNYLTTKYEALNKHISQNGGFGRDYVIRNQTQPKEVIEEFITVIDNTR
Ga0316616_10065851623300033521SoilATRYSEDVNVVFGLLKKYQPEIVIIHTLGGEKLDHEGSAYLMYLAFKKATKENVPVGKLWMTVNGWLLDKTAQKNGRGKPDVRIEVKDYLKTKYEALNKHVSQNGGFGREYVTKNEIQPREVMEEFITVIDNSD
Ga0316616_10230169513300033521SoilKLDHEGAAYMMYLAFKKAMDNKVPVGKLWMTVNGWLLDYPSNKNGRGNPDVRINVRDHLKTKYEALNKHVSQNGGFGREYVMEDGDQPKEIIEEFITVVDNTK
Ga0316616_10262405313300033521SoilKVIIYATEDFVRYDPPGRRQINLATRYNEDVNIVVELLEKYKPEIVITHTLGGEKLDHEGTAYMMYLAFVKAIDKNIPVGKLWMTVNGWLLDKDAQRSGRGKPDIKIDVRDHLKTKYEALNKHVSQNGGFGRDYVTDNKTQPKEVIEEFITVIDNMKK
Ga0316616_10351460213300033521SoilQPEIVITHTLGGEKLDHEGTAYMMYLAFTEAMRKNIPVGKLWMTVNGWLLDKEAQRTGRGKPDIRIEVKDYLKTKYEALNKHISQNGGFGREYVTDNETQPLESIEEFITVIDNMK
Ga0316616_10407828023300033521SoilVGKLWMTVNGWLLDNEAQKRGRGTPDVQINVSDHLKTKYEALNKHVSQNGGFGRDYVLDNKTQPKEIVEEFITVLDYTK
Ga0316617_10070076023300033557SoilKYEPEIVITHTLGGEKLDHEGTAYLMYVAFEKARTRNIPVGKLWMTVNGWLLDEFSQKNGRGKPDVHIDVKNYLTTKYEALNKHISQNGGFGRDYVIRNQTQPKEVIEEFITVIDNTR
Ga0316617_10210581123300033557SoilSEDVNVVYDILKQYKPEIVITHTLGGEKLDHEGTAYMIYLAFKKAMDNKVPVGKLWMTINGWLLDTTSQKNGRGKPDVHIDVRNHLKTKYEALDKHLSQNGGSGREYVIKNRTQPKEVIEEFITVIDNTK
Ga0316617_10247690913300033557SoilLATRYSEDVNVVFELLKKYEPEIVIIHTLGGEKLDHEGSAYLMYLAFKKAMEWKVPVGKLWMTVNGWLLDYPNNKNGRGKPDVRIEVKDYLHTKYEALNKHVSQNGGFGRDYVMKDGDQPKEVIEEFITVIDNM
Ga0370498_106350_46_4293300034155Untreated Peat SoilVDVVVDLLKKYQPEIVITHTLGGEKLDHEGTAYMMYLAFKKAKDKNIPVGKLWMTVNGWLLDTEAQRRGRGKPDIQIDVRDYLKTKYEALNKHVSQNGGYGRDYVIDNKTQPKEITEEFITVLDYTK
Ga0370480_0035568_1237_17103300034169Untreated Peat SoilVIIYGTQDFLNYGAPGRKQISLATRYSEDVNVVYRLLQQYEPEIVITHTLGGEKLDHEGTAYMVYLAFKKAMNTNVSVGKLWMTVNGWLLDNTAQKNGRGRPDVRINVKNYLPIKYEALNKHVSQNGGFGRDYVIGNETQPKEVVEEFITVIDNIKK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.