NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F097998

Metagenome / Metatranscriptome Family F097998

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F097998
Family Type Metagenome / Metatranscriptome
Number of Sequences 104
Average Sequence Length 52 residues
Representative Sequence MALFFHSDDVDQLISFKEAVEITESALRDLVSPRGVNAPRKRLNLHRDIAEG
Number of Associated Samples 96
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 96.15 %
% of genes near scaffold ends (potentially truncated) 97.12 %
% of genes from short scaffolds (< 2000 bps) 91.35 %
Associated GOLD sequencing projects 95
AlphaFold2 3D model prediction Yes
3D model pTM-score0.33

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.192 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(9.615 % of family members)
Environment Ontology (ENVO) Unclassified
(42.308 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(37.500 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 32.50%    β-sheet: 0.00%    Coil/Unstructured: 67.50%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.33
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF00248Aldo_ket_red 66.35
PF12974Phosphonate-bd 3.85
PF09084NMT1 2.88
PF02423OCD_Mu_crystall 2.88
PF01314AFOR_C 1.92
PF13419HAD_2 1.92
PF13242Hydrolase_like 1.92
PF13414TPR_11 0.96
PF02730AFOR_N 0.96
PF00857Isochorismatase 0.96
PF04909Amidohydro_2 0.96
PF05866RusA 0.96
PF13360PQQ_2 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 2.88
COG2414Aldehyde:ferredoxin oxidoreductaseEnergy production and conversion [C] 2.88
COG2423Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin familyAmino acid transport and metabolism [E] 2.88
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 2.88
COG1335Nicotinamidase-related amidaseCoenzyme transport and metabolism [H] 0.96
COG1535Isochorismate hydrolaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.96
COG4570Holliday junction resolvase RusA (prophage-encoded endonuclease)Replication, recombination and repair [L] 0.96


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.19 %
UnclassifiedrootN/A4.81 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_116599713All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_60_19611Open in IMG/M
3300002104|C687J26621_10215405All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria567Open in IMG/M
3300002120|C687J26616_10131082Not Available793Open in IMG/M
3300003324|soilH2_10053673All Organisms → cellular organisms → Bacteria3045Open in IMG/M
3300003987|Ga0055471_10094646All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4869Open in IMG/M
3300003996|Ga0055467_10046809All Organisms → cellular organisms → Bacteria1104Open in IMG/M
3300003996|Ga0055467_10216584All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium595Open in IMG/M
3300004019|Ga0055439_10218350All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium615Open in IMG/M
3300004049|Ga0055493_10090544All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium641Open in IMG/M
3300004643|Ga0062591_100580141All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium985Open in IMG/M
3300004643|Ga0062591_101278604All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium720Open in IMG/M
3300004778|Ga0062383_10019935All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2363Open in IMG/M
3300004778|Ga0062383_10649850All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium537Open in IMG/M
3300005093|Ga0062594_102420013All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium574Open in IMG/M
3300005178|Ga0066688_10988324All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium513Open in IMG/M
3300005293|Ga0065715_10194068All Organisms → cellular organisms → Bacteria1398Open in IMG/M
3300005295|Ga0065707_10384551All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium872Open in IMG/M
3300005338|Ga0068868_100065446All Organisms → cellular organisms → Bacteria2888Open in IMG/M
3300005353|Ga0070669_101042844All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium703Open in IMG/M
3300005440|Ga0070705_101659524All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium539Open in IMG/M
3300005457|Ga0070662_101206340All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium650Open in IMG/M
3300005468|Ga0070707_101482759All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium645Open in IMG/M
3300006169|Ga0082029_1645876All Organisms → cellular organisms → Bacteria1290Open in IMG/M
3300006796|Ga0066665_11105035All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium604Open in IMG/M
3300006804|Ga0079221_10018814All Organisms → cellular organisms → Bacteria2782Open in IMG/M
3300006844|Ga0075428_102051076All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium592Open in IMG/M
3300006845|Ga0075421_102472786All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium542Open in IMG/M
3300006846|Ga0075430_100208726All Organisms → cellular organisms → Bacteria1621Open in IMG/M
3300006847|Ga0075431_100759212All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium945Open in IMG/M
3300006847|Ga0075431_102139867All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium514Open in IMG/M
3300006853|Ga0075420_101067266All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium695Open in IMG/M
3300007076|Ga0075435_101374861All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium619Open in IMG/M
3300009012|Ga0066710_104603532Not Available515Open in IMG/M
3300009087|Ga0105107_10521327All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium828Open in IMG/M
3300009089|Ga0099828_11541606All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium586Open in IMG/M
3300009094|Ga0111539_12310668All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium624Open in IMG/M
3300009148|Ga0105243_10219604All Organisms → cellular organisms → Bacteria1679Open in IMG/M
3300009156|Ga0111538_10352826All Organisms → cellular organisms → Bacteria1862Open in IMG/M
3300009157|Ga0105092_10019035All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria3612Open in IMG/M
3300009177|Ga0105248_10445392All Organisms → cellular organisms → Bacteria1459Open in IMG/M
3300009296|Ga0103681_1217189All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria755Open in IMG/M
3300009553|Ga0105249_12153871All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium630Open in IMG/M
3300010036|Ga0126305_10685662All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium692Open in IMG/M
3300010166|Ga0126306_10866936All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium731Open in IMG/M
3300010397|Ga0134124_12251887All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium585Open in IMG/M
3300010399|Ga0134127_10234246All Organisms → cellular organisms → Bacteria1729Open in IMG/M
3300011119|Ga0105246_10973373All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium766Open in IMG/M
3300011429|Ga0137455_1031475All Organisms → cellular organisms → Bacteria1467Open in IMG/M
3300011435|Ga0137426_1053596All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1062Open in IMG/M
3300011439|Ga0137432_1232611All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium594Open in IMG/M
3300012038|Ga0137431_1237378All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium511Open in IMG/M
3300012173|Ga0137327_1035075All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1078Open in IMG/M
3300012174|Ga0137338_1149488All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium510Open in IMG/M
3300012203|Ga0137399_11740991All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium512Open in IMG/M
3300012514|Ga0157330_1067211All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium547Open in IMG/M
3300012519|Ga0157352_1078585All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium548Open in IMG/M
3300012882|Ga0157304_1117007All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium505Open in IMG/M
3300012922|Ga0137394_11114379All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium653Open in IMG/M
3300012960|Ga0164301_10383092All Organisms → cellular organisms → Bacteria978Open in IMG/M
3300012971|Ga0126369_10538602All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1231Open in IMG/M
3300013297|Ga0157378_10173146All Organisms → cellular organisms → Bacteria2026Open in IMG/M
3300014271|Ga0075326_1010811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_42150Open in IMG/M
3300014296|Ga0075344_1151343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4514Open in IMG/M
3300014304|Ga0075340_1048016All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium739Open in IMG/M
3300014320|Ga0075342_1081793All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium823Open in IMG/M
3300014880|Ga0180082_1061866All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium808Open in IMG/M
3300015259|Ga0180085_1036816All Organisms → cellular organisms → Bacteria1384Open in IMG/M
3300015261|Ga0182006_1309081All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium519Open in IMG/M
3300015373|Ga0132257_102961223All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium619Open in IMG/M
3300015374|Ga0132255_101123843All Organisms → cellular organisms → Bacteria1182Open in IMG/M
3300016270|Ga0182036_11855780All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium511Open in IMG/M
3300016371|Ga0182034_11411182All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium609Open in IMG/M
3300016422|Ga0182039_10513084All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1037Open in IMG/M
3300017965|Ga0190266_10938033All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium572Open in IMG/M
3300018031|Ga0184634_10408342All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium618Open in IMG/M
3300018079|Ga0184627_10213527All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1019Open in IMG/M
3300018432|Ga0190275_10490650All Organisms → cellular organisms → Bacteria1260Open in IMG/M
3300018476|Ga0190274_12540747Not Available609Open in IMG/M
3300020197|Ga0194128_10526523All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium538Open in IMG/M
3300021081|Ga0210379_10075221All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1380Open in IMG/M
3300021081|Ga0210379_10543297All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium517Open in IMG/M
3300022534|Ga0224452_1261760All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium529Open in IMG/M
3300025313|Ga0209431_10266643All Organisms → cellular organisms → Bacteria1346Open in IMG/M
3300025313|Ga0209431_11017264All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300025324|Ga0209640_10031907All Organisms → cellular organisms → Bacteria4590Open in IMG/M
3300025327|Ga0209751_10399550Not Available1141Open in IMG/M
3300025327|Ga0209751_10446798All Organisms → cellular organisms → Bacteria1065Open in IMG/M
3300025893|Ga0207682_10507472All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium571Open in IMG/M
3300025904|Ga0207647_10250103All Organisms → cellular organisms → Bacteria1017Open in IMG/M
3300025942|Ga0207689_11231863Not Available630Open in IMG/M
3300025972|Ga0207668_11861775All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium543Open in IMG/M
3300025981|Ga0207640_12170901All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium504Open in IMG/M
3300026058|Ga0208421_1012712All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium736Open in IMG/M
3300027513|Ga0208685_1008752All Organisms → cellular organisms → Bacteria2530Open in IMG/M
3300027775|Ga0209177_10220903All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium685Open in IMG/M
3300027909|Ga0209382_12238202All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium516Open in IMG/M
3300028381|Ga0268264_11236421All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium757Open in IMG/M
3300031199|Ga0307495_10254762All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium507Open in IMG/M
3300031820|Ga0307473_11152785All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium574Open in IMG/M
3300031824|Ga0307413_11520400All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium592Open in IMG/M
3300032180|Ga0307471_100557016All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1301Open in IMG/M
3300032180|Ga0307471_103623310All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium546Open in IMG/M
3300032205|Ga0307472_100158663All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1664Open in IMG/M
3300033481|Ga0316600_11180303All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium543Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere9.62%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil8.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.73%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil5.77%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands4.81%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands4.81%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.85%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.88%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.92%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.92%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment1.92%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.92%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.92%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.92%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.92%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.92%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.92%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.92%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.96%
GroundwaterEnvironmental → Aquatic → Freshwater → Drinking Water → Chlorinated → Groundwater0.96%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater0.96%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.96%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.96%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.96%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.96%
Termite NestEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest0.96%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.96%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.96%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002104Groundwater microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_0.2EnvironmentalOpen in IMG/M
3300002120Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2EnvironmentalOpen in IMG/M
3300003324Sugarcane bulk soil Sample H2EnvironmentalOpen in IMG/M
3300003987Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2EnvironmentalOpen in IMG/M
3300003996Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2EnvironmentalOpen in IMG/M
3300004019Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2EnvironmentalOpen in IMG/M
3300004049Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D2EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300004778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3FreshEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300006169Termite nest microbial communities from Madurai, IndiaEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009087Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009296Microbial communities from groundwater in Rifle, Colorado, USA-3A_0.2umEnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011429Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2EnvironmentalOpen in IMG/M
3300011435Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2EnvironmentalOpen in IMG/M
3300011439Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2EnvironmentalOpen in IMG/M
3300012038Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2EnvironmentalOpen in IMG/M
3300012173Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT517_2EnvironmentalOpen in IMG/M
3300012174Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT366_2EnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012514Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510EnvironmentalOpen in IMG/M
3300012519Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610EnvironmentalOpen in IMG/M
3300012882Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2EnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014271Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2EnvironmentalOpen in IMG/M
3300014296Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D1EnvironmentalOpen in IMG/M
3300014304Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D1EnvironmentalOpen in IMG/M
3300014320Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1EnvironmentalOpen in IMG/M
3300014880Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_16_10DEnvironmentalOpen in IMG/M
3300015259Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10DEnvironmentalOpen in IMG/M
3300015261Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaGHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300020197Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65mEnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300022534Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1EnvironmentalOpen in IMG/M
3300025313Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes)EnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025327Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026058Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027513Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300031199Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_SEnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033481Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CTEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_11659971313300000956SoilMPLFFHSDDVDQLIPIKEAVEITENALRDMISPDGVC
C687J26621_1021540513300002104GroundwaterVALFFHSDDVDHLISLKEAVAIAESALKDIPLRAGVNAPRKRLNLHRNGGEYP
C687J26616_1013108213300002120SoilMALFFHSDDVDDLIPFKEAVSIAENALKDLRSPKGTNAPRKRLH
soilH2_1005367323300003324Sugarcane Root And Bulk SoilMALFFHSDEVDQLIPFKEAVSITEQALRDMISPGGVCAPRKRLNLHREIGEARFDTGDTR
Ga0055471_1009464623300003987Natural And Restored WetlandsMALFFHSDEVDQSIPFKEAVQITEAALRDMVSPKGVNAPRKRLNLHREIGEEKFDTV
Ga0055467_1004680923300003996Natural And Restored WetlandsVALFFHSDDVDQLIPFKEAVQITEEALRDLISPKGVNAPRKRLNLHRNVGEASFDTVLNI
Ga0055467_1021658423300003996Natural And Restored WetlandsVALFFHSDDIDQLISFKDAVQITEHALADLVSPRGVNAPRKRLN
Ga0055439_1021835013300004019Natural And Restored WetlandsMALFFHSDDVDQLIQIKEAVAITENSLCDMISPSGVCAPRKRLHLHRNVGEGTFD
Ga0055493_1009054423300004049Natural And Restored WetlandsMALFFHSDDVDQLIPIKEAVQITEDALRDMITPSGVCAPRKRLNLHRNVGEGT
Ga0062591_10058014113300004643SoilMALFFHSDDVDQMIPIKEAVQITEEALRDMITPAGVCAPRKRLNLHRNVAEGTFDTVLNIYAG
Ga0062591_10127860423300004643SoilMALFFHSDDVDQLIPIKEAVEITENALRDMISPDGVCAPRKRLNL
Ga0062383_1001993543300004778Wetland SedimentMALFFHSDDVDQLIPIKEAVEITENSLRDMISPEGVCAPRKRLNLHRNVGEGTFDT
Ga0062383_1064985023300004778Wetland SedimentMALFFHSDDVDQLIPIKDAVQITENSLRDMILPQGVCAPRKRLNLHRNVGEGTFDTVLNI
Ga0062594_10242001313300005093SoilMALFFHSDDVDRLIPFKEAVQITEAALRDWVSPAGVNAPRKRLNLHRKVAEGTF
Ga0066688_1098832423300005178SoilMALFFHSDDVDQLIPIKEAVQISENALKDLVSGSGVNAPRKRLNLHRNIGEGTFDTVLNIYAGGSA
Ga0065715_1019406823300005293Miscanthus RhizosphereMALFFHSDDVDQLISFKEAIEITESALRDLVSPRGVNAPRKRLNLHRDIAEGSFDTVLNV
Ga0065707_1038455113300005295Switchgrass RhizosphereMALFFHSDDVDQLISFKEAVEITESALRDLLSPRGVNAPRKRLNLHRDITEGSFDTVLNVYA
Ga0068868_10006544643300005338Miscanthus RhizosphereMALFFHSDDVDQLISFKEAVEITESALRDLVSPRGVNAPRKRLNLHRDIAEGSFDTVLNV
Ga0070669_10104284423300005353Switchgrass RhizosphereMALFFHSDDVDQLIPFKEAVQITENAMRDMISSDGVCAPRKRLNLHRNVAEGSFDTVLNIYAGGAAS
Ga0070705_10165952423300005440Corn, Switchgrass And Miscanthus RhizosphereMALFFHSDDVDQLISFKEAVEITESALRDLVSPRGVNAPRKRLNLHRD
Ga0070662_10120634013300005457Corn RhizosphereVALFFHSDEVDEFIPFTEAVAIVENALRAIKTPAGVNAPRKRLNLHRDIA
Ga0070707_10148275913300005468Corn, Switchgrass And Miscanthus RhizosphereMALFFHSDDVDQLIPIKEAVQISENALKDLVSPSGVNAPRKRLN
Ga0082029_164587613300006169Termite NestVALFFHSDEVDEFIPFTEAVAISENALRNIKTRAGVNAPRKRLNLHR
Ga0066665_1110503513300006796SoilMPLFFHSDDVDQLIPFKEAVQITENALRDMISSEGVCAPRKRLTLHRN
Ga0079221_1001881443300006804Agricultural SoilMALFFHSDDVDQLISLKEAVEITESALRDLLSPRGVNAPRKRLNLHRDI
Ga0075428_10205107623300006844Populus RhizosphereVALFFHSDEVDEFIPFKEAVAISEDALRDLKTPAGVNAPRKRLNLHRDIAEG
Ga0075421_10247278623300006845Populus RhizosphereVALFFHSDEVDEFIPFTEAVAIAENALRDLKTQAGVNAPRKRL
Ga0075430_10020872613300006846Populus RhizosphereVALFFHSDEVDEFIPFTEAVAISENALRDLKTPAGVNAPR
Ga0075431_10075921223300006847Populus RhizosphereMPLFFHSDEVDQLIPIREAVQITENALRDMISPAGVCAPRKRLNLHRNVAEGT
Ga0075431_10213986713300006847Populus RhizosphereMALFFHSDDVDQMIPFREAVEITENALRDMISPDGVCAPRKRLNLHRNVAEG
Ga0075420_10106726623300006853Populus RhizosphereMALFFHSDDVDQLIPIKEAVAITENALRDMISPDGVCAPRKRLNLHRNVAEGTFDTVLNI
Ga0075435_10137486123300007076Populus RhizosphereMALFFHSDDVDQLISFKDAVELTESALRDLLSPRGVNAPRKRLNLHREIAEGSFDTVL
Ga0066710_10460353223300009012Grasslands SoilMALFFHSDEVDQQIPFKEAVQITENALRDTVSPKGVNAPR
Ga0105107_1052132713300009087Freshwater SedimentVALFFHSDDVDQLIPFKEAVQVTEKALRDLVSPEGVNAPRKRLNLHRDVGEGS
Ga0099828_1154160623300009089Vadose Zone SoilMALFFHSDDVDHLISIKEAVGITESALRDISLRAGVNAPRKRLNLHRNVGEYPYDTVLN
Ga0111539_1231066813300009094Populus RhizosphereMALFFHSDDVDQLIPIKEAVEITENALRDTISPDGVCAPRKRLNLHRNVAEGTFDTVLNIYAGG
Ga0105243_1021960413300009148Miscanthus RhizosphereMALFFHSDDVDQLISFKEAVEITESALRDLVSPRGVNAPRKRLNLHRDIAEGSFDT
Ga0111538_1035282633300009156Populus RhizosphereMALFFHSDDVDQLISFKEAVEITESALRDLVSPRGVNAPRKRLNL
Ga0105092_1001903553300009157Freshwater SedimentMALFFHSDEVDQRIPFKEAVQITENALRDLVSPKGVNAPRKRLNLHRQI
Ga0105248_1044539233300009177Switchgrass RhizosphereMALFFHSDDVDQLISFKEAVEITESALRDAVSPRGVNAPRK
Ga0103681_121718923300009296GroundwaterVALFFHSDDVDHLISLKEAVAIAESALKDIPLRAGGNAPRTRLNLHRNGGEYPYDTLL
Ga0105249_1215387113300009553Switchgrass RhizosphereMALFFHSDDVDQLISLKEAVEITESALRDLLSPRGVNAPRKRLN
Ga0126305_1068566223300010036Serpentine SoilMALFFHSDDVDQMIPIKDAVQITEDALRDMISPAGVCAP
Ga0126306_1086693623300010166Serpentine SoilMALFFHSDDVDQMIPIKDAVQITEDALRDMISPAGVCAPRKRL
Ga0134124_1225188723300010397Terrestrial SoilMALFFHSDDVDQLISFKEAVEITESALRDLLSPRGVNAPRKRLNLHRDIAEGSFDTVLNVYAGGS
Ga0134127_1023424633300010399Terrestrial SoilMALFFHSDDVDRLIPFKEAVQITEAALRDWVSPAGVNAPR
Ga0105246_1097337313300011119Miscanthus RhizosphereMALFFHSDDVDQLISFKEAVEITESALRDAVSPRGVNAPRKRLNLHRDIAELAR*
Ga0137455_103147513300011429SoilMALFFHSDDVDQLIPIKKAVEITENALRDMISPDGVCAPRKRLNLHRNVAEGTFDTV
Ga0137426_105359633300011435SoilMALFFHSDEVDQQIPFKEAVQITENALRDLISSKGVNASRKRLNLHREIGEE
Ga0137432_123261123300011439SoilMALFFHSDDVDQMIPFKEAVEITERALCDMISPDGVCAPRKRLNLHRNVAEGTFDTVLNIYA
Ga0137431_123737823300012038SoilMALFFHSDDVDQMISIKDAVRITEDALRDMITPSGVCAPRKRLNLHRNVGEGTFDTVL
Ga0137327_103507523300012173SoilMALFFHSDEVDQQIPFKEAVQITENALRDLLSPKGVNAPRKRLNLHREIGEEKFDTVLN
Ga0137338_114948823300012174SoilVALFFHSDDVDQLIPFKEAVQITENALRDMVSPDGVNAPRKRLN
Ga0137399_1174099123300012203Vadose Zone SoilMPLFFHSDDVDQLIPFKEAVQITENALRDMISSDGVCAPRKRLNLHRNIAEGSFDTVLNIYAGGAA
Ga0157330_106721123300012514SoilMALFFHSDDVDQLIPFKEAVQITENALRDMISSEGVCAPRKRLNLHRNIAEGSFDT
Ga0157352_107858523300012519Unplanted SoilMALFFHSDDVDQLISFKEAVEITESALRDLLSPSGVNAPRKRLNLHRDVA
Ga0157304_111700713300012882SoilMALFFHSDDVDQLISFKEAVEITESALRDLVSPRGVNAPRKRLNLHRDIA
Ga0137394_1111437923300012922Vadose Zone SoilMPLFFHSDDVDQLIPFNEAVQITENALRDMISSEGVCAPRK
Ga0164301_1038309223300012960SoilMALFFHSDDVDQLIPFKEAVQITENALRDMISSDGVCAPRKRLNLHR
Ga0126369_1053860213300012971Tropical Forest SoilMALFFHSDDVDHLISIKEAVEISENALRDISLRAGVNAPRKRLNLHRKAGEYHMTRCST
Ga0157378_1017314633300013297Miscanthus RhizosphereMALFFHSDDVDQLIFFLDAAQTTENALRDMISSEGVCAPRK
Ga0075326_101081113300014271Natural And Restored WetlandsMALFFHSDEVDQSIPFKEAVQITEDALRDMVSPRG
Ga0075344_115134313300014296Natural And Restored WetlandsMALFFHSDEVDQSIPFKEAVQITEDALRDMVSPKGVNAPRKRLNLHREIGEEKFDTV
Ga0075340_104801623300014304Natural And Restored WetlandsMALFFHSDDVDQLIPIKEAVQITEDALRDMITPSGVCAPRKRLNLHRNVGEGTF
Ga0075342_108179323300014320Natural And Restored WetlandsMALFFHSDDVDQQIPFKDAVQITENALRDMISSKGVNAPRKRLNLHREIGE
Ga0180082_106186613300014880SoilMALFFHSDDVDQLIPIKDAVEITEAALRDMIAASGVCAPRKRLNLHRNVAEGTFDTVLN
Ga0180085_103681613300015259SoilVALFFHSDDVDQLIPFKEAVQITENALRDMVSPEGVNAPRKRLNLHRQIGEGKFDTV
Ga0182006_130908123300015261RhizosphereMALFFHSDDVDQLISFKEAIEITESALRDLVSPRGVNAPRKRLNLHRDIAEGSFD
Ga0132257_10296122313300015373Arabidopsis RhizosphereMALFFHSDHVDQLIPFKEAVQITENALRDMILSEGVCAPRKRLTLHRNVAEGSFDTVLNIYAGG
Ga0132255_10112384323300015374Arabidopsis RhizosphereMALFFHSDDVDQLIPFKEAVQITENALRDMISSDGVCA
Ga0182036_1185578013300016270SoilMALFFHSDDVDQLIPFKEAVEITESALRDLVSPRGVNAPRKRLNLHRDIAEGSFDTVLNI
Ga0182034_1141118213300016371SoilMALFFHSDEVDQQIPFKEAVQITENALRDMVSPKGVNAPRKRLNLHREIGEGKFD
Ga0182039_1051308423300016422SoilMALFFHSDDVDQLIPFKEAVEITESALRDLVSPRGVNAPRKRLNLHRDIAEGSFDTVLNIYAGGSA
Ga0190266_1093803323300017965SoilMALFFHSDDVDQMIPIKDAVRITEDALRDMITPSGVCAPRK
Ga0184634_1040834223300018031Groundwater SedimentVAERLREVVSLVMALFFHSDDVDQLIPIREAVEITESALRDMISPNGVCAPRKRLNLHRNVAE
Ga0184627_1021352723300018079Groundwater SedimentMALFFHSDDVDQLTPIREAVEITESALCDMISPNGVCAPRKRLNLHRNVAEGTFDTVL
Ga0190275_1049065013300018432SoilVALFFHSDDVDELIPFTEAVAIAENALRGLKTPAGVNAP
Ga0190274_1254074723300018476SoilMPLFFHSDDVDQMISIKDAVKITEDALRDMISPAGVCAPR
Ga0194128_1052652323300020197Freshwater LakeMALFFHSDDVDQLIPTGEAVAITESALRDMISPNGVCAPRKRLNLHRKV
Ga0210379_1007522113300021081Groundwater SedimentMALFFHSDEVDQQIPFKEAVQITENALRDTVSPKGVNAPRKRLNLHRE
Ga0210379_1054329723300021081Groundwater SedimentVALFFHSDDVDQLIPFKEAVEITENALRDMVSPKGVNAPRKRLNLHRQIGEAKFDTVLNIYAG
Ga0224452_126176013300022534Groundwater SedimentVALFFHSDDVDQLIAFTEAVQITEAALRDLVSAQGVNAPRKRLNLHRDVGEG
Ga0209431_1026664343300025313SoilMALFFHSDDVDDLIPFKEAVSIAENALKDLRSPKGTNAPRKRLHIHRDVGEGRYDTVLN
Ga0209431_1101726423300025313SoilMALFFHSDDVDDLIPFKEAVSIAEDALKDLRSPKGTNAPRKRLHIHRDLGESPYDTVLNI
Ga0209640_1003190713300025324SoilVALFFHSDDVDQLIPIKEAVEITESALRDVISPDGV
Ga0209751_1039955013300025327SoilMALFFHSDDVDDLIPFKEAVSIAENALKDLRSPKGTNAPRKRLHIQRDHGEGPYD
Ga0209751_1044679823300025327SoilMALFFHSDDVDDLIPFKEAVSIAEDALKDLRSPKG
Ga0207682_1050747223300025893Miscanthus RhizosphereMALFFHSDDVDQMIPITDAVQITEDALRDMISPAGVCAPRKRLNLHRSIGEGSFDTVLNI
Ga0207647_1025010313300025904Corn RhizosphereMALFFHSDDVDQLISFKEAVEITESALRDLVSPRGVNAPRKRLNLHRDIAEG
Ga0207689_1123186323300025942Miscanthus RhizosphereMALFFHSDDVDQLISFKEAVEITESALRDLVSPRGVNAPRKRLNLHRDIAE
Ga0207668_1186177523300025972Switchgrass RhizosphereMALFFHSDDVDQLIPFKEAVQITENALRDMISSEGV
Ga0207640_1217090123300025981Corn RhizosphereMALFFHSDDVDQLIPFKEAVQITENALRDMVSPRGVN
Ga0208421_101271223300026058Natural And Restored WetlandsVALFFHSDDVDQLIPFKEAVQITEFALRDLVSPKGVNAPRKRLNLHRDIGEASF
Ga0208685_100875243300027513SoilMALFFHSDDVDQLIAINDAVQITENALRDMITPSGVCAPRKRLNLHRNVGEG
Ga0209177_1022090323300027775Agricultural SoilMALFFHSDDVDQLISFKEAVEITESALRDLVSPRGVNAPRKRLNLHRDVAEGSFDTVLNVYAGGSA
Ga0209382_1223820223300027909Populus RhizosphereMALFFHSDDVDQMIPFREAVEITENALRDMISPDGVCAPRKRL
Ga0268264_1123642123300028381Switchgrass RhizosphereMALFFHSDDVDQLISFKEAVEITESALRDLVSPRGVNAPRKRLNLHRDITEGSFDTVLNVYAGG
Ga0307495_1025476213300031199SoilMALFFHSDDVDQLIPFKEAVQITENALRDMISSDGVCAPRKRLNLHRNI
Ga0307473_1115278513300031820Hardwood Forest SoilMALFFHSDEVDQQIPFKEAVQITENALRDLVSPKGVNAPRKRLNLH
Ga0307413_1152040013300031824RhizosphereMALFFHSDDVDKMIPIKEAVQITEDALRDMITPSGVCAPRKRLNLHRNVGEGSFDTVLNIYAGGSA
Ga0307471_10055701613300032180Hardwood Forest SoilMALFFHSDEVDQQIPFTEAVQITENALRDTVSPKGVNAPRKRLNLHREIGEGKFDTVLNIYAG
Ga0307471_10362331013300032180Hardwood Forest SoilMALFFHSDDVDQLIPIKEAVQISENALKDLVSGSGVNAPRKRLNLHRNIGEDTFDTVLNIYA
Ga0307472_10015866333300032205Hardwood Forest SoilMALFFHSDEVDQQIPFTEAVQITENALRDTVSPKGVNAPRKRLNLHREIGEGKFDTVLNIYAGSA
Ga0316600_1118030323300033481SoilMALFFHSDDVDQMIPIKEAVQITEDALRDMITPSGVCAPRKRLNLHRNV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.