NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F094386

Metagenome / Metatranscriptome Family F094386

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F094386
Family Type Metagenome / Metatranscriptome
Number of Sequences 106
Average Sequence Length 124 residues
Representative Sequence MEYTEYYELFKQYPEWEVEHENHKEGFNGKRNFELEKAITKLVAEDETLFLYQERTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRN
Number of Associated Samples 91
Number of Associated Scaffolds 106

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 98.11 %
% of genes near scaffold ends (potentially truncated) 99.06 %
% of genes from short scaffolds (< 2000 bps) 92.45 %
Associated GOLD sequencing projects 78
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.057 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(28.302 % of family members)
Environment Ontology (ENVO) Unclassified
(83.019 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(76.415 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 28.57%    β-sheet: 13.49%    Coil/Unstructured: 57.94%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 106 Family Scaffolds
PF03641Lysine_decarbox 40.57
PF00581Rhodanese 3.77
PF06293Kdo 0.94
PF13413HTH_25 0.94
PF16187Peptidase_M16_M 0.94
PF01786AOX 0.94
PF07687M20_dimer 0.94
PF13439Glyco_transf_4 0.94
PF02668TauD 0.94

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 106 Family Scaffolds
COG1611Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) familyNucleotide transport and metabolism [F] 40.57
COG2175Taurine dioxygenase, alpha-ketoglutarate-dependentSecondary metabolites biosynthesis, transport and catabolism [Q] 0.94

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10082959All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster1410Open in IMG/M
3300000226|SI34jun09_135mDRAFT_1071872All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria630Open in IMG/M
3300000928|OpTDRAFT_10194696All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria702Open in IMG/M
3300001349|JGI20160J14292_10124926All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium855Open in IMG/M
3300001353|JGI20159J14440_10045342All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster1716Open in IMG/M
3300001355|JGI20158J14315_10077567All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1233Open in IMG/M
3300002186|JGI24539J26755_10038373All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1528Open in IMG/M
3300002186|JGI24539J26755_10067187All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1063Open in IMG/M
3300002913|JGI26060J43896_10019780All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2151Open in IMG/M
3300003585|JGI26249J51723_1052608All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria634Open in IMG/M
3300003588|JGI26247J51722_1052528All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria792Open in IMG/M
3300003589|JGI26248J51725_1046065All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria785Open in IMG/M
3300004110|Ga0008648_10215805All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster520Open in IMG/M
3300006164|Ga0075441_10361864All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster526Open in IMG/M
3300006190|Ga0075446_10172296All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster611Open in IMG/M
3300006352|Ga0075448_10054560All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster1275Open in IMG/M
3300006352|Ga0075448_10262926All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster523Open in IMG/M
3300006947|Ga0075444_10249314All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster699Open in IMG/M
3300006947|Ga0075444_10319956All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster595Open in IMG/M
3300007558|Ga0102822_1174352All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster511Open in IMG/M
3300007637|Ga0102906_1161330All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria609Open in IMG/M
3300007715|Ga0102827_1098867All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria660Open in IMG/M
3300007992|Ga0105748_10469564All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster548Open in IMG/M
3300008253|Ga0105349_10491451All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster513Open in IMG/M
3300008961|Ga0102887_1138122All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium757Open in IMG/M
3300009003|Ga0102813_1054427All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1349Open in IMG/M
3300009049|Ga0102911_1090784All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria876Open in IMG/M
3300009071|Ga0115566_10502773All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster687Open in IMG/M
3300009071|Ga0115566_10664720All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria579Open in IMG/M
3300009071|Ga0115566_10667526All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria578Open in IMG/M
3300009079|Ga0102814_10120780All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1435Open in IMG/M
3300009080|Ga0102815_10493942All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria684Open in IMG/M
3300009086|Ga0102812_10116712All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1464Open in IMG/M
3300009420|Ga0114994_10915137All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster568Open in IMG/M
3300009420|Ga0114994_11112899All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster510Open in IMG/M
3300009422|Ga0114998_10580729All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster527Open in IMG/M
3300009443|Ga0115557_1084121All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster1365Open in IMG/M
3300009472|Ga0115554_1337449All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster593Open in IMG/M
3300009497|Ga0115569_10429941All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster567Open in IMG/M
3300009497|Ga0115569_10466024All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster538Open in IMG/M
3300009526|Ga0115004_10711020All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster596Open in IMG/M
3300009526|Ga0115004_10977888All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster507Open in IMG/M
3300009705|Ga0115000_10758155All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster597Open in IMG/M
3300009785|Ga0115001_10827645All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster557Open in IMG/M
3300012416|Ga0138259_1357857All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster718Open in IMG/M
3300017697|Ga0180120_10194655All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria842Open in IMG/M
3300020182|Ga0206129_10159689All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1053Open in IMG/M
3300020358|Ga0211689_1142949All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster666Open in IMG/M
3300021185|Ga0206682_10130593All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1206Open in IMG/M
3300021378|Ga0213861_10302357All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria821Open in IMG/M
(restricted) 3300022931|Ga0233433_10396686All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster542Open in IMG/M
(restricted) 3300022933|Ga0233427_10370721All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster583Open in IMG/M
(restricted) 3300024327|Ga0233434_1206217All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens715Open in IMG/M
3300024346|Ga0244775_10928755All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria690Open in IMG/M
3300025577|Ga0209304_1102341All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster647Open in IMG/M
3300025596|Ga0209662_1130358All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria576Open in IMG/M
3300025621|Ga0209504_1130799All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria620Open in IMG/M
3300025662|Ga0209664_1003118All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria7381Open in IMG/M
3300025672|Ga0209663_1003161All Organisms → cellular organisms → Bacteria → Proteobacteria7554Open in IMG/M
3300025688|Ga0209140_1139998All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria715Open in IMG/M
3300025690|Ga0209505_1196763All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster504Open in IMG/M
3300025709|Ga0209044_1174147All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster620Open in IMG/M
3300025722|Ga0209660_1002794All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria8414Open in IMG/M
3300025869|Ga0209308_10058685All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2003Open in IMG/M
3300025869|Ga0209308_10241597All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster779Open in IMG/M
3300025870|Ga0209666_1073916All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1740Open in IMG/M
3300025886|Ga0209632_10410544All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster642Open in IMG/M
3300025890|Ga0209631_10543733All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster507Open in IMG/M
3300025894|Ga0209335_10410981All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster541Open in IMG/M
3300027255|Ga0208681_1023605All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1183Open in IMG/M
3300027522|Ga0209384_1124135All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster590Open in IMG/M
3300027672|Ga0209383_1094287All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster1012Open in IMG/M
3300027704|Ga0209816_1284252All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster507Open in IMG/M
3300027714|Ga0209815_1041753All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster1717Open in IMG/M
3300027779|Ga0209709_10089044All Organisms → cellular organisms → Bacteria → Proteobacteria1650Open in IMG/M
3300027780|Ga0209502_10373798All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster592Open in IMG/M
3300027780|Ga0209502_10406329All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster556Open in IMG/M
3300027788|Ga0209711_10377755All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster588Open in IMG/M
3300027801|Ga0209091_10166892All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster1123Open in IMG/M
3300027813|Ga0209090_10156933All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster1198Open in IMG/M
3300027827|Ga0209035_10006531All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales5119Open in IMG/M
3300027833|Ga0209092_10120427All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1539Open in IMG/M
3300028196|Ga0257114_1337712All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster510Open in IMG/M
3300028197|Ga0257110_1124513All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster1058Open in IMG/M
3300031141|Ga0308021_10379780All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster518Open in IMG/M
3300031143|Ga0308025_1191030All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster704Open in IMG/M
3300031143|Ga0308025_1198488All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster686Open in IMG/M
3300031519|Ga0307488_10750257All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster546Open in IMG/M
3300031588|Ga0302137_1258925All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster580Open in IMG/M
3300031588|Ga0302137_1260200All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster578Open in IMG/M
3300031596|Ga0302134_10340207All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster561Open in IMG/M
3300031597|Ga0302116_1114092All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium876Open in IMG/M
3300031597|Ga0302116_1180854All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster636Open in IMG/M
3300031597|Ga0302116_1250778All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster510Open in IMG/M
3300031612|Ga0308009_10188915All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster774Open in IMG/M
3300031621|Ga0302114_10381914All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster530Open in IMG/M
3300031626|Ga0302121_10009797All Organisms → cellular organisms → Bacteria → Proteobacteria3507Open in IMG/M
3300031639|Ga0302117_10115740All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster1181Open in IMG/M
3300031676|Ga0302136_1014402All Organisms → cellular organisms → Bacteria → Proteobacteria2959Open in IMG/M
3300031676|Ga0302136_1186021All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster620Open in IMG/M
3300031683|Ga0308006_10124456All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster795Open in IMG/M
3300031694|Ga0308015_10448091All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster517Open in IMG/M
3300031696|Ga0307995_1071007All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster1405Open in IMG/M
3300031700|Ga0302130_1201959All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster607Open in IMG/M
3300031702|Ga0307998_1175898All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster737Open in IMG/M
3300031848|Ga0308000_10062232All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster1343Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine28.30%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine11.32%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine11.32%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine10.38%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine9.43%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine8.49%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine5.66%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater2.83%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.94%
MarineEnvironmental → Aquatic → Marine → Inlet → Unclassified → Marine0.94%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater0.94%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.94%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.94%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.94%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.94%
Methane Seep MesocosmEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Methane Seep Mesocosm0.94%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.94%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.94%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine0.94%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.94%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine0.94%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000226Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 135mEnvironmentalOpen in IMG/M
3300000928Marine plume microbial communities from the Columbia River - 25 PSUEnvironmentalOpen in IMG/M
3300001349Pelagic Microbial community sample from North Sea - COGITO 998_met_10EnvironmentalOpen in IMG/M
3300001353Pelagic Microbial community sample from North Sea - COGITO 998_met_09EnvironmentalOpen in IMG/M
3300001355Pelagic Microbial community sample from North Sea - COGITO 998_met_08EnvironmentalOpen in IMG/M
3300002186Marine eukaryotic phytoplankton communities from the Norwegian Sea - 10m ARK-5M MetagenomeEnvironmentalOpen in IMG/M
3300002913Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - AAIW_A/KNORR_S2/LVEnvironmentalOpen in IMG/M
3300003585Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_135m_DNAEnvironmentalOpen in IMG/M
3300003588Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_100m_DNAEnvironmentalOpen in IMG/M
3300003589Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_120m_DNAEnvironmentalOpen in IMG/M
3300004110Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_100m_DNAEnvironmentalOpen in IMG/M
3300006164Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNAEnvironmentalOpen in IMG/M
3300006190Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNAEnvironmentalOpen in IMG/M
3300006352Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNAEnvironmentalOpen in IMG/M
3300006947Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNAEnvironmentalOpen in IMG/M
3300007558Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.733EnvironmentalOpen in IMG/M
3300007637Estuarine microbial communities from the Columbia River estuary - metaG 1556A-02EnvironmentalOpen in IMG/M
3300007715Estuarine microbial communities from the Columbia River estuary - metaG S.751EnvironmentalOpen in IMG/M
3300007992Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2umEnvironmentalOpen in IMG/M
3300008253Methane-oxidizing microbial communities from mesocosms in the Hudson Canyon - EN1B Hudson CanyonEnvironmentalOpen in IMG/M
3300008961Estuarine microbial communities from the Columbia River estuary - metaG 1550B-02EnvironmentalOpen in IMG/M
3300009003Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725EnvironmentalOpen in IMG/M
3300009049Estuarine microbial communities from the Columbia River estuary - metaG 1558A-02EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009080Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759EnvironmentalOpen in IMG/M
3300009086Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713EnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009422Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138EnvironmentalOpen in IMG/M
3300009443Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421EnvironmentalOpen in IMG/M
3300009472Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404EnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300009526Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90EnvironmentalOpen in IMG/M
3300009705Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300012416Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA9.A_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300020182Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2EnvironmentalOpen in IMG/M
3300020358Marine microbial communities from Tara Oceans - TARA_B100000768 (ERX555925-ERR599009)EnvironmentalOpen in IMG/M
3300021185Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300022931 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_100_MGEnvironmentalOpen in IMG/M
3300022933 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_100_MGEnvironmentalOpen in IMG/M
3300024327 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_120_MGEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025577Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 (SPAdes)EnvironmentalOpen in IMG/M
3300025596Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_150m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025621Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 (SPAdes)EnvironmentalOpen in IMG/M
3300025662Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_150m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025672Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI073_LV_135m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025688Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_120m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025690Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 (SPAdes)EnvironmentalOpen in IMG/M
3300025709Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S4LV_130m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025722Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_100m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025869Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes)EnvironmentalOpen in IMG/M
3300025870Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025886Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300025894Pelagic Microbial community sample from North Sea - COGITO 998_met_09 (SPAdes)EnvironmentalOpen in IMG/M
3300027255Estuarine microbial communities from the Columbia River estuary - metaG 1558A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027522Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027672Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027704Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027714Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027779Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes)EnvironmentalOpen in IMG/M
3300027780Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes)EnvironmentalOpen in IMG/M
3300027788Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes)EnvironmentalOpen in IMG/M
3300027801Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes)EnvironmentalOpen in IMG/M
3300027813Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes)EnvironmentalOpen in IMG/M
3300027827Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - AAIW_A/KNORR_S2/LV (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028196Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10mEnvironmentalOpen in IMG/M
3300028197Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10mEnvironmentalOpen in IMG/M
3300031141Marine microbial communities from water near the shore, Antarctic Ocean - #351EnvironmentalOpen in IMG/M
3300031143Marine microbial communities from water near the shore, Antarctic Ocean - #422EnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031588Marine microbial communities from Western Arctic Ocean, Canada - CBN3_SCMEnvironmentalOpen in IMG/M
3300031596Marine microbial communities from Western Arctic Ocean, Canada - CB9_SCMEnvironmentalOpen in IMG/M
3300031597Marine microbial communities from Western Arctic Ocean, Canada - AG5_SCMEnvironmentalOpen in IMG/M
3300031612Marine microbial communities from water near the shore, Antarctic Ocean - #127EnvironmentalOpen in IMG/M
3300031621Marine microbial communities from Western Arctic Ocean, Canada - AG5_SurfaceEnvironmentalOpen in IMG/M
3300031626Marine microbial communities from Western Arctic Ocean, Canada - CB21_surfaceEnvironmentalOpen in IMG/M
3300031639Marine microbial communities from Western Arctic Ocean, Canada - AG5_32.2EnvironmentalOpen in IMG/M
3300031676Marine microbial communities from Western Arctic Ocean, Canada - CBN3_20mEnvironmentalOpen in IMG/M
3300031683Marine microbial communities from water near the shore, Antarctic Ocean - #69EnvironmentalOpen in IMG/M
3300031694Marine microbial communities from water near the shore, Antarctic Ocean - #231EnvironmentalOpen in IMG/M
3300031696Marine microbial communities from Ellis Fjord, Antarctic Ocean - #262EnvironmentalOpen in IMG/M
3300031700Marine microbial communities from Western Arctic Ocean, Canada - CB9_surfaceEnvironmentalOpen in IMG/M
3300031702Marine microbial communities from David Island wharf, Antarctic Ocean - #37EnvironmentalOpen in IMG/M
3300031848Marine microbial communities from water near the shore, Antarctic Ocean - #3EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1008295933300000101MarineMIEYKEYYELFKQNPEWEVEHDNHKEGFNGKGNPELEKAITEMVDNDDTLFFYEAKTFHFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFN
SI34jun09_135mDRAFT_107187223300000226MarineMEYTEYYELFKQYPEWEVEHENHKEGFNGKRNFELEKAITKLVAEDETLFLYQERTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRN
OpTDRAFT_1019469623300000928Freshwater And MarineMEYTEYYELFKQYPEWEVEHENHKEGFNGKRNFELEKAITKLVAEDETLFLYQERTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCD
JGI20160J14292_1012492623300001349Pelagic MarineMIEYKEYYELFKQNSEWEVEHDNHKEGFDGEGNPELEKAITEMVDNDDTLFFYEAKTFHFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEE
JGI20159J14440_1004534243300001353Pelagic MarineMEYTEYYELFKQYPEWEVEHENHKEGFNGKRNFDLEKAITKLVAEDETLFLYQERTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIXDRXRXGAGLPL
JGI20158J14315_1007756713300001355Pelagic MarineMDYTEYYELFKQYPECEVEHENHKEGFDGKRNFDLEKAIIKLVAEDETLFLYQERTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEQGYLCDLP
JGI24539J26755_1003837333300002186MarineMIEYKEYYELFKQNSEWEVEHDNHKEGFDGEGNPELEKAITEMVDNDDTLFFYEAKTFHFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQILD
JGI24539J26755_1006718713300002186MarineMEYTEYYELFKQYPECEVEHENHKDGFNGKRNFDLEKAITKLVAEDETLFLYQEQTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQILD
JGI26060J43896_1001978013300002913MarineMEYKEYYDLFAKYPEWEIEHEDHKEGFEGKGNDDLEKAIQEIVAKDDTLFLYKEKDFHFSMLLLNKQYADVDFWVCTTHALHDVTEHKQGLLDDGDYRLYFPNAEDPMGDEQDEEGYLCDLPLT
JGI26249J51723_105260813300003585MarineMEYTEYYELFKQYPEWEVEHENHKEGFNGKRNFELEKAITKLVAEDETLFLYQERTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQ
JGI26247J51722_105252813300003588MarineMDYTEYYELFKQYPECEVEHENHKEGFDGKRNFDLEKAIIKLVAEDETLFLYQERTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEI
JGI26248J51725_104606523300003589MarineMDYTEYYELFKQYPECEVEHENHKEGFDGKRNFDLEKAIIKLVAEDETLFLYQERTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEQGY
Ga0008648_1021580513300004110MarineMEYTEYYELFKQYPEWEVEHENHKEGFNGKRNFELEKAITKLVAEDETLFLYQERTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQ
Ga0075441_1036186413300006164MarineMEYAEYYDLFKKYPEWEIEHEDHKEGFEGKGNDDLEKAIQEIVAKDDTLFLYKEKDFHFSMLLLNKQYADVDFWVCTTHALHDVTEHKQGLLDDGDYRLYFPDAEDPMGEEQ
Ga0075446_1017229613300006190MarineMEYAEYYDLFKKYPEWEIEHEDHKEGFEGKGNDDLEKAILEIVAKDDTLFLYKEKDFHFSMLLLNKQYADVDFWVCTTHALHDVTEHKQGLLDDGDYRLYFPDAEDPMGEEQDEEGYLCDLPLTVKDTHYNIHEFEQILD
Ga0075448_1005456023300006352MarineLQENSKMEYIEYYDLFKKYPEWEIEHEDHKEGFEGKGNDDLEKAIQEIVAKDDTLFLYKEKDFHFSMLLLNKQYADVDFWVCTTHALHDVTEHKQGLLDDGDYRLYFPNAEDPMGDEQDEEGY
Ga0075448_1026292613300006352MarineMEYAEYYDLFKKYPEWEIEHEDHKEGFEGKGNDDLEKAILEIVAKDDTLFLYKEKDFHFSMLLLNKQYADVDFWVCTTHALHDVTEHKQGLLDDGDYRLYFPNAEDPMGDEQDEEGY
Ga0075444_1024931413300006947MarineMEYTEYYDLFKKYPEWEIEHEDHKEGFNGKGNDDLEKAIQEIVAKDDTLFLYKVKDFHFSILLLNKQYADVDFLVCTTHALHDVTEHKQGLLDDGDYRLYFPNAEDPM
Ga0075444_1031995613300006947MarineMIEYKEYYELFKQNSEWEVEHDNHKEGFNGEGNPELEKAITEMVDKDDTLFFYEAKTFHFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFE
Ga0102822_117435223300007558EstuarineVDYTEYYELFKQYPECEVEHENHKEGFDGKRNFDLEKAIIKLVAEDETLFLYQERTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPTGEEEQGYLCDLPLNVRNGHFNIEEFEQILDEI
Ga0102906_116133023300007637EstuarineMEYTEYYELFKQYPECEVEHENHKEGFNGKRNFELEKAITKLVAEDETLFLYQERTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNG
Ga0102827_109886723300007715EstuarineMDYTEYYELFKQYPECEVEHENHKEGFDGKRNFDLEKAIIKLVAEDETLFLYQERTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQILD
Ga0105748_1046956423300007992Estuary WaterMEYTEYYELFKQYPEWEVEHENHKEGFSGKRNFDLEKAITKLVSEDETLFLYQERTFNFSMLLLNKQYANLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEQGYLCDLPLNVRNGHFNI
Ga0105349_1049145113300008253Methane Seep MesocosmMIEYKEYYELFKQNPEWEVEHDNHKEGFNGKGNPELEKAITEMVDNDDTLFFYEAKTFHFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEQGYLCDLPLNVR
Ga0102887_113812213300008961EstuarineMIEYKEYYELFKQNSEWEVEHDNHKEGFNGKGNPELEKAITEMVDNDDTLFFYEAKTFHFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFE
Ga0102813_105442733300009003EstuarineMDYTEYYELFKQYPECEVEHENHKEGFDGKRNFDLEKAIIKLVAEDETLFLYQERTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEQGYLCDLPLNVRNGHFN
Ga0102911_109078423300009049EstuarineMEYTEYYELFKQYPEWEVEHENHKEGFNGKRNFELEKAITKLVAEDETLFLYQERTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIE
Ga0115566_1050277323300009071Pelagic MarineMIEYKEYYELFKQNSEWEVEHDNHKEGFDGEGNPELEKAITEMVDNDDTLFFYEAKTFHFSMLLLNKQYVDLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEVEQGYLCDLPLNVRNGHFNIEEF
Ga0115566_1066472023300009071Pelagic MarineMEYTEYYELFKQYPECEVEHENHKEGFNGKRNFDLEKAIIKLVAEDETLFLYQEQTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNI
Ga0115566_1066752623300009071Pelagic MarineMEYTEYYELFKQYPEWEVEHENHKEGFNGKRNFDLEKAITKLVAEDETLFLYQERTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGLIEEEEQGYLCDLPLNVRNGHFNIEEFE
Ga0102814_1012078033300009079EstuarineMDYTEYYELFKQYPECEVEHENHKEGFDGKRNFDLEKAIIKLVAEDETLFLYQERTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPTEEEEQGYLC
Ga0102815_1049394223300009080EstuarineMDYTEYYELFKQYPECEVEHENHKEGFDGKRNFDLEKAIIKLVAEDETLFLYQERTFNFSMLLLNKQYADLDFWVCTSHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEQGYLCDLPLNVRNGHFNIEEFEQILD
Ga0102812_1011671233300009086EstuarineMDYTEYYELFKQYPECEVEHENHKEGFDGKRNFDLEKAIIKLVAEDETLFLYQERTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNG
Ga0114994_1091513723300009420MarineMEYTEYYELFKQYPEWEVEHENHKEGFNGKRNFELEKAITKLVAEDETLFLYQERTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQILDE
Ga0114994_1111289923300009420MarineMEYAEYYELFKQYPEWEVEHENHKEGFSGKRNFDLEKAITKLVAEDETLFLYQERTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEEQGYLCDLPLNVRNSHFNIEEFEQILDE
Ga0114998_1058072923300009422MarineMIEYKEYYELFKQNSEWEVEHDNHKEGFNGEGNPELEKAITEMVDNDDTLFFYKAKTFHFSMLLLNKQYADLDFWVCTTHAFHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEE
Ga0115557_108412113300009443Pelagic MarineMEYKKYYELFKQNSEWEVEHDNHKEGFDGEGNPELEKAITEMVDNDDTLFFYEAKTFHFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRN
Ga0115554_133744913300009472Pelagic MarineMIEYKEYYELFKQNSEWEVEHDNHKEGFDGEGNPELEKAITEMVDNDDTLFFYEAKTFHFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLD
Ga0115569_1042994123300009497Pelagic MarineMEYTEYYELFKQYPEWEVEHENHKEGFDGKRNFDLEKAIIRLVAEDETLFLYQERTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEEEQGYLCDLPLNVRNGHFNIE
Ga0115569_1046602413300009497Pelagic MarineMIEYKEYYELFKQNSEWEVEHDNHKEGFDGEGNPELEKAITEMVDNDDTLFFYEAKTFHFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQI
Ga0115004_1071102013300009526MarineMIEYKEYYELFKQNSEWEVEHDNHKEGFNGEGNPELEKAITEMVDNDDTLFFYEAKTFHFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFE
Ga0115004_1097788813300009526MarineMIEYKEYYELFKQNSEWEVEHDNHKEGFNGEGNPELEKAITEMVDNDDTLFFYKAKTFHFSMLLLNKQYADLDFWVCTTHAFHDISEHKQGLLDDGDYRLYFEGAEGPI
Ga0115000_1075815513300009705MarineMIEYKEYYELFKQNSEWEVEHDNHKEGFNGEGNPELEKAITEMVDNDDTLFFYEAKSFHFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYL
Ga0115001_1082764513300009785MarineMIEYKEYYELFKQNSEWEVEHDNHKEGFNGEGNPELEKAITEMVDNDDTLFFYEAKTFHFSMLLLNKQYADLDFWVCTTHAFHDISEHKQGLLDDGDYRLYFEGAEGPIEE
Ga0138259_135785723300012416Polar MarineMEYKEYYDLFAKYPEWEIEHEDHKEGFEGKGNDDLEKAIQEIVAKDDTLFLYKEKDFHFSMLLLNKQYADVDFWVCTTHALHDVTEHKQGLLDDGDYRLYFPDAEDPMGDEQDEE
Ga0180120_1019465523300017697Freshwater To Marine Saline GradientMEYTEYYELFKQYPECEVEHENHKDGFNGKRNFDLEKAITKLVAEDETLFLYQEQTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVR
Ga0206129_1015968913300020182SeawaterMDYTEYYELFKQYPECEVEHENHKEGFDGKRNFDLEKAIIKLVAEDETLFLYQERTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEQGYLCDLPLNVRNGHFNIEEFEQILD
Ga0211689_114294923300020358MarineMEYKEYYDLFAKYPEWEIEHEDHKEGFEGKGNDDLEKAIQEIVAKDDTLFLYKEKDFHFSMLLLNKQYADVDFWVCTTHALHDVTEHKQGLLDDGDYRLYFPNAEDPMGDEQDEEG
Ga0206682_1013059323300021185SeawaterMDYTEYYELFKQYPECEVEHENHKEGFDGKRNFDLEKAIIKLVAEDETLFLYQERTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEQGYLCDLPLNVRNGHFNIEEF
Ga0213861_1030235713300021378SeawaterMEYTEYYELFKQYPECEVEHENHKDGFNGKRNFDLEKAITKLVAEDETLFLYQEQTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEDQGYLCDLPLNVRN
(restricted) Ga0233433_1039668613300022931SeawaterMDYTEYYELFKQYPECEVEHENHKEGFDGKRNFDLEKAIIKLVAEDETLFLYQERTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEQGYLCDLPLNVRNGHFNIEEFEQILDE
(restricted) Ga0233427_1037072113300022933SeawaterMIEYKEYYELFKQNPEWEVEHDNHKEGFNGKGNPELEKAITEMVDNDDTLFFYEAKTFHFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNI
(restricted) Ga0233434_120621713300024327SeawaterMEYTEYYELFKQYPEWEVEHENHKEGFDGKRNFDLEKAITRLVAEDETLFLYQERTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEEEQGYLCDLPL
Ga0244775_1092875513300024346EstuarineMEYTEYYELFKQYPEWEVEHENHKEGFNGKRNFELETAITKLVAEDETLFLYQERTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEDEQGYLCDLPLNVRNGHFNIEEFEQILDEIM
Ga0209304_110234113300025577Pelagic MarineMEYTEYYELFKQYPESEVEHDTHKEGFNGKRNIDLEQAITELVGKDNTLFFYKERPFHFSMLLLNKQYADLDFWVCTTHALHDVSEHKQGLLEDGDYRLYFDGAEGPIE
Ga0209662_113035813300025596MarineMEYTEYYELFKQYPEWEVEHENHKEGFNGKRNFELEKAITKLVAEDETLFLYQERTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEQGYLCD
Ga0209504_113079923300025621Pelagic MarineMEYTEYYELFKQYPEWEIEHENHKEGFNGKRNFELEKAITKLVAEDETLFLYQERTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLEDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGYFNIEEFE
Ga0209664_100311893300025662MarineMDYTEYYELFKQYPECEVEHENHKEGFDGKRNFDLEKAIIKLVAEDETLFLYQERTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPTEEEEQGYLCDLPLNVRNGHFNIEEF
Ga0209663_100316113300025672MarineMDYTEYYELFKQYPECEVEHENHKEGFDGKRNFDLEKAIIKLVAEDETLFLYQERTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIMTF
Ga0209140_113999813300025688MarineMDYTEYYELFKQYPECEVEHENHKEGFDGKRNFDLEKAIIKLVAEDETLFLYQERTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQILDEIM
Ga0209505_119676313300025690Pelagic MarineMIEYKEYYELFKQNSEWEVEHDNHKEGFDGEGNPELEKAITEMVDNDDTLFFYEAKTFHFSMLLLNKQYVDLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPI
Ga0209044_117414713300025709MarineMIEYKEYYELFKQNSEWEVEHDNHKEGFDGEGNPELEKAITEMVNNDDTLFFYEAKTFRFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAE
Ga0209660_1002794113300025722MarineMEYTEYYELFKQYPEWEVEHENHKEGFDGKRNFDLEKAITRLVAEDETLFLYQERTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEEEQGYLC
Ga0209308_1005868513300025869Pelagic MarineMDYTEYYELFKQYPECEVEHENHKEGFDGKRNFDLEKAIIKLVAEDETLFLYQERTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEQGYLCDLPLNVRNGHFNIEEFEQILDEI
Ga0209308_1024159713300025869Pelagic MarineMIEYKEYYELFKQNSEWEVEHDNHKEGFDGEGNPELEKAITEMVDNDDTLFFYEAKTFHFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQILDE
Ga0209666_107391633300025870MarineMIEYKEYYELFKQNSEWEVEHDNHKEGFNGKGNPELEKAITEMVNNDDTLFFYEAKTFRFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPVEEEEEDQGYL
Ga0209632_1041054413300025886Pelagic MarineMIEYKEYYELFKQNSEWEVEHDNHKEGFDGEGNPELEKAITEMVDNDDTLFFYEAKTFHFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEE
Ga0209631_1054373313300025890Pelagic MarineMMEYKEYYELFKQYPEWEIEHHNHKEGFNGEGNPELEQALVEMVEKDDTLFLYKEKAFHFSMLLLNKQYADIDFWVCTTHALHDVSEHKQGLLDDGDYRLYFADA
Ga0209335_1041098113300025894Pelagic MarineMEYTEYYELFKQYPECEVEHENHKEGFNGKRNFDLEKAIIKLVAEDETLFLYQEQTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEQGYLCDLPLNVRNGHFNIEEF
Ga0208681_102360513300027255EstuarineVDYTEYYELFKQYPECEVEHENHKEGFDGKRNFDLEKAIIKLVAEDETLFLYQERTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIE
Ga0209384_112413513300027522MarineMEYKEYYDLFAKYPEWEIEHEDHKEGFEGKGNDDLEKAIQEIVAKDDTLFLYKEKDFHFSKLLLNKQYADVDFWVCTTHALHDVTEHKQGLLDDGDYRLYFPDAEDPM
Ga0209383_109428713300027672MarineMEYIEYYDLFKKYPEWEIEHEDHKEGFEGKGNDDLEKAIQEIVAKDDTLFLYKEKDFHFSMLLLNKQYADVDFWVCTTHALHDVTEHKQGLLDDGDYRLYFPNAEDPMGDEQDEEGYLCD
Ga0209816_128425213300027704MarineMEYIEYYDLFKKYPEWEIEHEDHKEGFEGKGNDDLEKAIQEIVRKDDTLFLYKEKDFHFSMLLLNKQYADVDFWVCTTHALHDVTEHKQGLLDDGDYRLYFPDAEDPMGDEQDEEGYLCDLPLTVKDTHYNIHEFEQILDE
Ga0209815_104175333300027714MarineLQENSKMEYIEYYDLFKKYPEWEIEHEDHKEGFEGKGNDDLEKAIQEIVAKDDTLFLYKEKDFHFSMLLLNKQYADVDFWVCTTHALHDVTEHKQGLLDDGDYRLYFPNAEDP
Ga0209709_1008904413300027779MarineMIEYKEYYELFKQNSEWEVEHDNHKEGFNGEGNPELEKAITEMVDNDDTLFFYETKTFHFSMLLLNKQYADLDFWVCTTHALHDVSEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNG
Ga0209502_1037379823300027780MarineMIEYKEYYELFKQNSEWEVEHDNHKEGFNGEGNPELEKAITEMVDNDDTLFFYETKTFHFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEDEEEQGYLCDLPLNVR
Ga0209502_1040632923300027780MarineMIEYKEYYELFKQNSEWEVEHDNHKEGFNGEGNPELEKAITEMVDNDDTLFFYKAKTFHFSMLLLNKQYADLDFWVCTTHAFHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEEGYLCDLPLNVR
Ga0209711_1037775523300027788MarineMIEYKEYYELFKQNSEWEVEHDNHKEGFNGEGNPELEKAITEMVDNDDTLFFYETKTFHFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDD
Ga0209091_1016689213300027801MarineMIEYKEYYELFKQNSEWEVEHDNHKEGFNGEGNPELEKAITEMVDNDDTLFFYETKTFHFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLP
Ga0209090_1015693323300027813MarineMIEYKEYYELFKQNSEWEVEHDNHKEGFDGEGNPELEKAITEMVDNDDTLFFYEAKTFHFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCD
Ga0209035_1000653173300027827MarineMEYAEYYDLFKKYPEWEIEHEDHKEGFEGKGNDDLEKAILEIVAKDDTLFLYKEKDFHFSMLLLNKQYADVDFWVCTTHALHDVTEHKQGLLDDGDYRLYFPDAEDPMGEEQGE
Ga0209092_1012042743300027833MarineMDYTEYYELFKQYPECEVEHENHKEGFDGKRNFDLEKAIIKLVAEDETLFLYQERTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEQGYLC
Ga0257114_133771213300028196MarineMEYAEYYELFKQYPEWEVEHENHKEGFSGKRNFDLEKAITKLVAEDETLFLYQERTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEEQGYLCDLPLNVRNSHFN
Ga0257110_112451323300028197MarineMIEYKEYYELFKQNSEWEVEHDNHKEGFDGEGNPELEKAITEMVDNDDTLFFFEAKTFHFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIEEFEQ
Ga0308021_1037978013300031141MarineMEYKEYYDLFAKYPEWEIEHEDHKEGFEGKGNDDLEKAIQEIVAKDDTLFLYKEKDFHFSMLLLNKQYADVDFWVCTTHALHDVTEHKQGLLDDGDYRLYFPNAEDPMGDEQDEEGYLCDLPLTVKDTHYNIHEFEQILDEILT
Ga0308025_119103013300031143MarineMEYKEYYDLFAKYPEWEIEHEDHKEGFEGKGNDDLEKAIQEIVAKDDTLFLYKEKDFHFSMLLLNKQYADVDFWVCTTHALHDVTEHKQGLLDDGDYRLYFPDAEDPMGDEQDEEGYLCDLPLTVKDTHYNIHEFEQILDEILT
Ga0308025_119848813300031143MarineMEYIEYYDLFKKYPEWEIEHEDHKEGFEGKGNDDLEKAIQEIVAKDDTLFLYKEKDFHFSMLLLNKQYADVDFWVCTTHALHDVTEHKQGLLDDGDYRLYFPNAEDPMGDEQDEEGYLCDLPLTVKDTHYNIHEFEQILDEILT
Ga0307488_1075025723300031519Sackhole BrineMIEYKEYYELFKQNSEWEVEHDNHKEGFNGEGNPELEKAITEIVDNDDTLFFYEAKTFHFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEQGYLCDLPLNVKNGHFNIE
Ga0302137_125892523300031588MarineMIEYKEYYELFKQNSEWEVEHDNHKEGFDGEGNPELEKAITEMVDNDDTLFFYEAKTFHFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYL
Ga0302137_126020023300031588MarineMIEYKEYYELFKQNSEWEVEHDNHKEGFNGEGNPELEKAITEMVDNDDTLFFYETKTFHFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGY
Ga0302134_1034020723300031596MarineMIEYKEYYELFKQNSEWEVEHDNHKEGFNGEGNPELEKAITEMVDNDDTLFFYETKTFHFSMLLLNKQYADLDFWVCTTHALHDVS
Ga0302116_111409223300031597MarineMEYTEYYDLFKKYPEWEIEHEDHKEGFEGKGNDDLEKAIQEIVAKDDTLFLYKEKDFHFSMLLLNKQYADVDFWVCTTHALHDVTEHKQGLLDDGDYRLYFPDAEDPMGGEQDEEGYLCDLPLTVKDSHYNIYE
Ga0302116_118085423300031597MarineMIEYKEYYELFKQNSEWEVEHDNHKEGFNGEGNPELEKAITEMVDNDDTLFFYETKTFHFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQ
Ga0302116_125077813300031597MarineMIEYKEYYELFKQNSEWEVEHDNHKEGFDGEGNPELEKAITEMVDNDDTLFFYEAKTFHFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGP
Ga0308009_1018891523300031612MarineMEYKEYYDLFAKYPEWEIEHEDHKEGFEGKGNDDLEKAIQEIVAKDDTLFLYKEKDFHFSMLLLNKQYADVDFWVCTTHALHDVTEHKQGLLDDGDYRLYFPDAEDPMGDEQDEEGYLCDLPLTVKDTHYNI
Ga0302114_1038191423300031621MarineMIEYKEYYELFKQNSEWEVEHDNHKEGFNGEGNPELEKAITEMVDNDDTLFFYETKTFHFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLY
Ga0302121_1000979713300031626MarineLPTLPFKNFLEKNSQMEYAEYYELFKQYPEWEVEHENHKEGFSGKRNFDLEKAITKLVAEDETLFLYQERTFNFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYL
Ga0302117_1011574013300031639MarineMIEYKEYYELFKQNSEWEVEHDNHKEGFDGEGNPELEKAITEMVDNDDTLFFYEAKTFHFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLCDLPLNVRNGHFNIE
Ga0302136_101440263300031676MarineMIEYKEYYELFKQNPEWEVEHDNHKEGFDGEGNPELEKAITEMVDNDDTLFFYEAKTFHFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGAEGPIEEEEEQGYLC
Ga0302136_118602113300031676MarineMIEYKEYYELFKQNSEWEVEHDNHKEGFNGEGNPELEKAITEMVDNDDTLFFYETKTFHFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEG
Ga0308006_1012445623300031683MarineMEYKEYYDLFAKYPEWEIEHEDHKEGFEGKGNDDLEKAIQEIVAKDDTLFLYKEKDFHFSMLLLNKQYADVDFWVCTTHALHDVTEHKQGLLDDGDYRLYFPDAEDPMGDEQDEEGYLCDLPLTVKDT
Ga0308015_1044809113300031694MarineMEYKEYYDLFAKYPEWEIEHEDHKEGFEGKGNDDLEKAIQEIVAKDDTLFLYKEKDFHFSMLLLNKQYADVDFWVCTTHALHDVTEHKQGLLDDGDYRLYFPDAEDPMGDEQDEEGYLCDLPLTVKDTHYNIHEFEQI
Ga0307995_107100723300031696MarineMIEYKEYYELFKQNSEWEVEHDNHKEGFNGEGNPELEKAITEMVDKDDTLFFYEAKTFHFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGA
Ga0302130_120195913300031700MarineMIEYKEYYELFKQNSEWEVEHDNHKEGFNGEGNPELEKAITEMVDNDDTLFFYEAKTFHFSMLLLNKQYADLDFWVCTTHALHDISEHKQGLLDDGDYRLYFEGA
Ga0307998_117589823300031702MarineMEYKEYYDLFAKYPEWEIEHEDHKEGFEGKGNDDLEKAIQEIVAKDDTLFLYKEKDFHFSMLLLNKQYADVDFWVCTTHALHDVTEHKQGLLDDGDYRLYFPDAEDPMGDEQDEEGYLCD
Ga0308000_1006223223300031848MarineMEYKEYYDLFAKYPEWEIEHEDHKEGFEGKGNDDLEKAIQEIVAKDDTLFLYKEKDFHFSMLLLNKQYADVDFWVCTTHALHDVTEHKQGLLDDGDYRLYFPDAEDPMGDEQDEEGYLCDLPLTV

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.